RegulonDB RegulonDB 10.8: Gene Form
   

frmR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

frmA yaiO frmR

Gene      
Name: frmR    Texpresso search in the literature
Synonym(s): ECK0354, G6209, b0357, yaiN
Genome position(nucleotides): 379606 <-- 379881 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.26
External database links:  
ASAP:
ABE-0001226
ECHOBASE:
EB3081
OU-MICROARRAY:
b0357
PortEco:
frmR
STRING:
511145.b0357
COLOMBOS: frmR


Product      
Name: DNA-binding transcriptional repressor FrmR
Synonym(s): FrmR, YaiN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.318
Isoelectric point: 5.919
Motif(s):
 
Type Positions Sequence
7 -> 87 EKKKVLTRVRRIRGQIDALERSLEGDAECRAILQQIAAVRGAANGLMAEVLESHIRETFDRNDCYSREVSQSVDDTIELVR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.5 - action unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0046872 - metal ion binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
External database links:  
DIP:
DIP-48245N
ECOCYC:
G6209-MONOMER
ECOLIWIKI:
b0357
INTERPRO:
IPR038390
INTERPRO:
IPR003735
PANTHER:
PTHR33677
PDB:
5LBM
PFAM:
PF02583
PRIDE:
P0AAP3
PRODB:
PRO_000022696
REFSEQ:
NP_414891
SMR:
P0AAP3
UNIPROT:
P0AAP3


Operon      
Name: frmRAB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB