RegulonDB RegulonDB 10.8: Gene Form
   

yaiO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD1 insD1 yaiO insC1 frmR anti-terminator terminator TSS_486 (cluster) TSS_486 (cluster) yaiOp5 yaiOp5 yaiOp4 yaiOp4 yaiOp6 yaiOp6

Gene      
Name: yaiO    Texpresso search in the literature
Synonym(s): ECK0355, G6210, b0358
Genome position(nucleotides): 380069 <-- 380842 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.13
External database links:  
ASAP:
ABE-0001230
ECHOBASE:
EB3082
OU-MICROARRAY:
b0358
PortEco:
yaiO
STRING:
511145.b0358
COLOMBOS: yaiO


Product      
Name: outer membrane protein YaiO
Synonym(s): YaiO
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 29.04
Isoelectric point: 7.688
Motif(s):
 
Type Positions Sequence
1 -> 19 MIKRTLLAAAIFSALPAYA
20 -> 257 GLTSITAGYDFTDYSGDHGNRNLAYAELVAKVENATLLFNLSQGRRDYETEHFNATRGQGAVWYKWNNWLTTRTGIAFADNTPVFARQDFRQDINLALLPKTLFTTGYRYTKYYDDVEVDAWQGGVSLYTGPVITSYRYTHYDSSDAGGSYSNMISVRLNDPRGTGYTQLWLSRGTGAYTYDWTPETRYGSMKSVSLQRIQPLTEQLNLGLTAGKVWYDTPTDDFNGLQLAARLTWKF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Molina F., et al., 2015
External database links:  
ECOCYC:
G6210-MONOMER
ECOLIWIKI:
b0358
INTERPRO:
IPR030887
INTERPRO:
IPR016504
PRIDE:
Q47534
REFSEQ:
NP_414892
SMR:
Q47534
UNIPROT:
Q47534


Operon      
Name: yaiO         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaiOp6 380850 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiOp4 380957 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiOp5 380973 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_486 (cluster) 381322 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Molina F., Lopez-Acedo E., Tabla R., Roa I., Gomez A., Rebollo JE., 2015, Improved detection of Escherichia coli and coliform bacteria by multiplex PCR., BMC Biotechnol 15:48

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB