RegulonDB RegulonDB 10.8: Gene Form
   

insC1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD1 yaiP insD1 yaiO insC1 anti-terminator terminator TSS_486 (cluster) TSS_486 (cluster) yaiOp5 yaiOp5 yaiOp4 yaiOp4 yaiOp6 yaiOp6

Gene      
Name: insC1    Texpresso search in the literature
Synonym(s): ECK0357, G6212, b0360, yi21-1
Genome position(nucleotides): 381351 --> 381716 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.01
External database links:  
ASAP:
ABE-0001237
ECOO157CYC:
Z0365
ECOO157CYC:
Z4315
ECOO157CYC:
Z3154
ECOO157CYC:
Z1927
ECOO157CYC:
Z5096
ECOO157CYC:
Z1826
OU-MICROARRAY:
b0360
PortEco:
insC-1
STRING:
511145.b4272
COLOMBOS: insC1


Product      
Name: IS2 element protein InsA
Synonym(s): InsC1
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.452
Isoelectric point: 10.175
Motif(s):
 
Type Positions Sequence
8 -> 87 EKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAAGEQVVPASELAAAMKQIKELQRLL

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
ECOCYC:
G6212-MONOMER
ECOLIWIKI:
b0360
ECOO157CYC:
Z4315-MONOMER
ECOO157CYC:
Z5096-MONOMER
ECOO157CYC:
Z3154-MONOMER
ECOO157CYC:
Z1927-MONOMER
ECOO157CYC:
Z1826-MONOMER
ECOO157CYC:
Z0365-MONOMER
INTERPRO:
IPR009057
INTERPRO:
IPR002514
PFAM:
PF01527
PRIDE:
P0CF40
REFSEQ:
NP_414894
SMR:
P0CF40
UNIPROT:
P0CF40


Operon      
Name: insC1CD1D1         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaiOp6 380850 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yaiOp4 380957 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yaiOp5 380973 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_486 (cluster) 381322 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB