RegulonDB RegulonDB 10.8: Gene Form
   

insD1 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insCD1 yaiP insD1 insC1

Gene      
Name: insD1    Texpresso search in the literature
Synonym(s): ECK0358, G6213, b0361, yi22-1
Genome position(nucleotides): 381674 --> 382579 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.08
External database links:  
ASAP:
ABE-0001239
OU-MICROARRAY:
b0361
PortEco:
insD-1
STRING:
511145.b4273
COLOMBOS: insD1


Product      
Name: IS2 element protein
Synonym(s): InsD1
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.398
Isoelectric point: 9.121
Motif(s):
 
Type Positions Sequence
124 -> 243 ESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRD
62 -> 104 ELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLE
106 -> 289 KPAVPPSKRAHTGRVAVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAVERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTIKRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
GO:0015074 - DNA integration
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7480-MONOMER
ECOLIWIKI:
b0361
ECOO157CYC:
Z0322-MONOMER
INTERPRO:
IPR036397
INTERPRO:
IPR025948
INTERPRO:
IPR012337
INTERPRO:
IPR001584
MODBASE:
P0CF53
PFAM:
PF00665
PFAM:
PF13276
PRIDE:
P0CF53
PROSITE:
PS50994
REFSEQ:
NP_414895
SMR:
P0CF53
UNIPROT:
P0CF53


Operon      
Name: insC1CD1D1         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaiOp6 380850 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yaiOp4 380957 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yaiOp5 380973 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_486 (cluster) 381322 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB