RegulonDB RegulonDB 10.8: Gene Form
   

yaiS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yaiP tauA yaiS ykiC CysB Cbl CysB CysB terminator tauAp tauAp yaiSp14 yaiSp14 yaiSp13 yaiSp13 yaiSp9 yaiSp9 yaiSp12 yaiSp12 yaiPp5 yaiPp5

Gene      
Name: yaiS    Texpresso search in the literature
Synonym(s): ECK0361, G6216, b0364
Genome position(nucleotides): 384059 <-- 384616 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.37
External database links:  
ASAP:
ABE-0001249
ECHOBASE:
EB3087
OU-MICROARRAY:
b0364
PortEco:
yaiS
STRING:
511145.b0364
COLOMBOS: yaiS


Product      
Name: putative deacetylase YaiS
Synonym(s): YaiS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.487
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
20 -> 141 LAIGAHPDDIELGCGASLARLAQKGIYIAAVVMTTGNSGTDGIIDRHEESRNALKILGCHQTIHLNFADTRAHLQLNDMISALEDIIKNQIPSDVEIMRVYTMHDADRHQDHLAVYQASMVA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
DIP:
DIP-11278N
ECOCYC:
G6216-MONOMER
ECOLIWIKI:
b0364
INTERPRO:
IPR024078
INTERPRO:
IPR003737
MODBASE:
P71311
PANTHER:
PTHR12993
PFAM:
PF02585
PRIDE:
P71311
REFSEQ:
NP_414898
SMR:
P71311
UNIPROT:
P71311


Operon      
Name: yaiS         
Operon arrangement:
Transcription unit        Promoter
yaiS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaiPp5 383985 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiSp12 384701 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiSp9 384708 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiSp13 384738 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiSp14 384830 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB