RegulonDB RegulonDB 10.9: Gene Form
   

tauA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tauA tauB yaiS ykiC tauC CysB Cbl CysB CysB terminator tauAp tauAp yaiSp14 yaiSp14 yaiSp13 yaiSp13 yaiSp9 yaiSp9 yaiSp12 yaiSp12

Gene      
Name: tauA    Texpresso search in the literature
Synonym(s): ECK0362, G6217, b0365, ssiA, yaiR
Genome position(nucleotides): 385232 --> 386194 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.28
Reference(s): [1] van der Ploeg JR., et al., 1996
External database links:  
ASAP:
ABE-0001256
ECHOBASE:
EB3085
ECOLIHUB:
tauA
OU-MICROARRAY:
b0365
STRING:
511145.b0365
COLOMBOS: tauA


Product      
Name: taurine ABC transporter periplasmic binding protein
Synonym(s): Ssi1, SsiA, TauA, YaiR, taurine transport system periplasmic protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 34.266
Isoelectric point: 7.732
Motif(s):
 
Type Positions Sequence
66 -> 66 R
312 -> 312 Q
23 -> 320 VNVTVAYQTSAEPAKVAQADNTFAKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGNSEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIAAWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVKAFAKSAIDAQQPYIANPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAELTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ
24 -> 247 NVTVAYQTSAEPAKVAQADNTFAKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGNSEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIAAWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVKAFAKSAIDAQQPYIANPDVWLKQPE
1 -> 22 MAISSRNTLLAALAFIAFQAQA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.4 - amines
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.2 - sulfur metabolism
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0022857 - transmembrane transporter activity
GO:0042959 - alkanesulfonate transmembrane transporter activity
biological_process GO:0006790 - sulfur compound metabolic process
GO:0009970 - cellular response to sulfate starvation
GO:0015734 - taurine transport
GO:0055085 - transmembrane transport
GO:0042918 - alkanesulfonate transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
TAUA-MONOMER
ECOLIWIKI:
b0365
INTERPRO:
IPR007210
INTERPRO:
IPR001638
INTERPRO:
IPR010068
MODBASE:
Q47537
PANTHER:
PTHR30024:SF33
PDB:
6STL
PDB:
6ST1
PDB:
6ST0
PDB:
6SSY
PFAM:
PF04069
PRIDE:
Q47537
PRODB:
PRO_000024033
REFSEQ:
NP_414899
SMART:
SM00062
SMR:
Q47537
UNIPROT:
Q47537


Operon      
Name: tauABCD         
Operon arrangement:
Transcription unit        Promoter
tauABCD


Transcriptional Regulation      
Display Regulation             
Activated by: Cbl, CysB


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaiSp12 384701 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiSp9 384708 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiSp13 384738 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiSp14 384830 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] van der Ploeg JR., Weiss MA., Saller E., Nashimoto H., Saito N., Kertesz MA., Leisinger T., 1996, Identification of sulfate starvation-regulated genes in Escherichia coli: a gene cluster involved in the utilization of taurine as a sulfur source., J Bacteriol 178(18):5438-46

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB