RegulonDB RegulonDB 10.8: Gene Form
   

insF2 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF2 insF2 iprA insE2 ytiB yaiVp4 yaiVp4 TSS_488 TSS_488 insFp4 insFp4 insFp5 insFp5

Gene      
Name: insF2    Texpresso search in the literature
Synonym(s): ECK0299, G6223, b0372, tra5-1
Genome position(nucleotides): 391739 <-- 392605 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.13
External database links:  
ASAP:
ABE-0001277
OU-MICROARRAY:
b0372
PortEco:
insF-2
COLOMBOS: insF2


Product      
Name: IS3 element protein InsF
Synonym(s): InsF2
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 33.54
Isoelectric point: 10.145
Motif(s):
 
Type Positions Sequence
53 -> 101 VLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRK
124 -> 287 YASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQFENKNL
127 -> 240 GPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
biological_process GO:0006310 - DNA recombination
GO:0032196 - transposition
GO:0015074 - DNA integration
External database links:  
ECOCYC:
MONOMER0-4441
INTERPRO:
IPR012337
INTERPRO:
IPR036397
INTERPRO:
IPR025948
INTERPRO:
IPR001584
PANTHER:
PTHR42648
PFAM:
PF00665
PFAM:
PF13276
PRIDE:
P0CF80
PROSITE:
PS50994
REFSEQ:
NP_414906
SMR:
P0CF80
UNIPROT:
P0CF80


Operon      
Name: insEF2E2F2         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insFp5 392619 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter insFp4 392660 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_488 392979 reverse nd [RS-EPT-CBR] [2]
  promoter yaiVp4 394461 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB