RegulonDB RegulonDB 10.8: Gene Form
   

yaiW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sbmA yaiW yaiY

Gene      
Name: yaiW    Texpresso search in the literature
Synonym(s): ECK0373, G6227, b0378
Genome position(nucleotides): 397872 --> 398966 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.42
External database links:  
ASAP:
ABE-0001299
ECHOBASE:
EB3375
OU-MICROARRAY:
b0378
PortEco:
yaiW
STRING:
511145.b0378
COLOMBOS: yaiW


Product      
Name: surface-exposed outer membrane lipoprotein
Synonym(s): YaiW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,outer membrane
Molecular weight: 40.414
Isoelectric point: 10.101
Motif(s):
 
Type Positions Sequence
50 -> 363 VKDRDAWAKDLATTFESQGLAPTLENVCSVLAVAQQESNYQADPAVPGLSKIAWQEIDRRAERMHIPAFLVHTALKIKSPNGKSYSERLDSVRTEKQLSAIFDDLINMVPMGQTLFGSLNPVRTGGPMQVSIAFAEQHTKGYPWKMDGTVRQEVFSRRGGLWFGTYHLLNYPASYSAPIYRFADFNAGWYASRNAAFQNAVSKASGVKLALDGDLIRYDSKEPGKTELATRKLAAKLGMSDSEIRRQLEKGDSFSFEETALYKKVYQLAETKTGKSLPREMLPGIQLESPKITRNLTTAWFAKRVDERRARCMK

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0031240 - external side of cell outer membrane
biological_process GO:0006351 - transcription, DNA-templated
GO:1901652 - response to peptide
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[AUPEINH] Assay of unpurified protein expressed in its native host
[HIFS] Human inference of function from sequence
Reference(s): [1] Arnold MF., et al., 2014
[2] Perez-Rueda E., et al., 2000
[3] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-11282N
ECOCYC:
G6227-MONOMER
ECOLIWIKI:
b0378
INTERPRO:
IPR011673
PFAM:
PF07759
PRIDE:
P77562
PRODOM:
PD041438
REFSEQ:
NP_414912
SMR:
P77562
UNIPROT:
P77562


Operon      
Name: sbmA-yaiW         
Operon arrangement:
Transcription unit        Promoter
sbmA-yaiW


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Arnold MF., Caro-Hernandez P., Tan K., Runti G., Wehmeier S., Scocchi M., Doerrler WT., Walker GC., Ferguson GP., 2014, Enteric YaiW is a surface-exposed outer membrane lipoprotein that affects sensitivity to an antimicrobial peptide., J Bacteriol 196(2):436-44

 [2] Perez-Rueda E., Collado-Vides J., 2000, The repertoire of DNA-binding transcriptional regulators in Escherichia coli K-12., Nucleic Acids Res 28(8):1838-47

 [3] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50


RegulonDB