RegulonDB RegulonDB 10.8: Gene Form
   

yaiY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yaiW yaiY yaiZ TSS_492 (cluster) TSS_492 (cluster) yaiYp6 yaiYp6 yaiYp5 yaiYp5 yaiZp yaiZp yaiZp6 yaiZp6

Gene      
Name: yaiY    Texpresso search in the literature
Synonym(s): ECK0374, G6228, b0379
Genome position(nucleotides): 399025 <-- 399333 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.43
External database links:  
ASAP:
ABE-0001302
ECHOBASE:
EB4027
OU-MICROARRAY:
b0379
PortEco:
yaiY
STRING:
511145.b0379
COLOMBOS: yaiY


Product      
Name: inner membrane protein
Synonym(s): YaiY
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 11.424
Isoelectric point: 10.189
Motif(s):
 
Type Positions Sequence
25 -> 45 IAYALFVLFCFWAGAQLLNLL
1 -> 101 MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLLVHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRR
75 -> 95 IFGLIPFLVGCLIFAVVALWL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6228-MONOMER
ECOLIWIKI:
b0379
INTERPRO:
IPR020513
PFAM:
PF10954
PRIDE:
P0AAP7
PRODOM:
PD068630
REFSEQ:
NP_414913
UNIPROT:
P0AAP7


Operon      
Name: yaiY         
Operon arrangement:
Transcription unit        Promoter
yaiY
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yaiZp6 399444 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yaiYp5 399460 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yaiYp6 399547 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_492 (cluster) 399570 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB