RegulonDB RegulonDB 10.8: Gene Form
   

yaiI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: yaiI    Texpresso search in the literature
Synonym(s): ECK0382, G6230, b0387
Genome position(nucleotides): 405764 --> 406222 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.43
External database links:  
ASAP:
ABE-0001344
ECHOBASE:
EB2968
OU-MICROARRAY:
b0387
PortEco:
yaiI
STRING:
511145.b0387
COLOMBOS: yaiI


Product      
Name: DUF188 domain-containing protein YaiI
Synonym(s): YaiI
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 16.969
Isoelectric point: 5.321
Motif(s):
 
Type Positions Sequence
17 -> 143 ILYRAAERMQMPLVLVANQSLRVPPSRFIRTLRVAAGFDVADNEIVRQCEAGDLVITADIPLAAEAIEKGAAALNPRGERYTPATIRERLTMRDFMDTLRASGIQTGGPDSLSQRDRQAFAAELEKW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6230-MONOMER
ECOLIWIKI:
b0387
INTERPRO:
IPR003791
PANTHER:
PTHR35146
PFAM:
PF02639
PRIDE:
P0A8D3
REFSEQ:
NP_414921
SMR:
P0A8D3
UNIPROT:
P0A8D3


Operon      
Name: yaiI         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_496 405666 reverse nd [RS-EPT-CBR] [1]
  promoter yaiIp7 405698 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiIp6 405708 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiIp3 405723 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_498 406276 forward nd [RS-EPT-CBR] [1]