RegulonDB RegulonDB 10.7: Gene Form
   

thiL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thiL yajO pgpA nusB TSS_536 TSS_536

Gene      
Name: thiL    Texpresso search in the literature
Synonym(s): ECK0411, G6234, b0417, thiJ
Genome position(nucleotides): 435634 --> 436611 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.4
External database links:  
ASAP:
ABE-0001452
ECHOBASE:
EB4149
OU-MICROARRAY:
b0417
PORTECO:
thiL
REGULONDB:
b0417
STRING:
511145.b0417
M3D: thiL
COLOMBOS: thiL
PortEco: b0417


Product      
Name: thiamine monophosphate kinase
Synonym(s): ATP:thiamine-phosphate phosphotransferase, ThiJ, ThiL
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.071
Isoelectric point: 4.279
Motif(s):
 
Type Positions Sequence
121 -> 122 GD
29 -> 138 DDCALLNIPEKQTLAISTDTLVAGNHFLPDIDPADLAYKALAVNLSDLAAMGADPAWLTLALTLPDVDEAWLESFSDSLFDLLNYYDMQLIGGDTTRGPLSMTLGIHGFV
150 -> 299 KPGDWIYVTGTPGDSAAGLAILQNRLQVADAKDADYLIKRHLRPSPRILQGQALRDLANSAIDLSDGLISDLGHIVKASDCGARIDLALLPFSDALSRHVEPEQALRWALSGGEDYELCFTVPELNRGALDVALGHLGVPFTCIGQMTAD
254 -> 254 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.8 - thiamin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0009030 - thiamine-phosphate kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000287 - magnesium ion binding
biological_process GO:0009228 - thiamine biosynthetic process
GO:0016310 - phosphorylation
GO:0009229 - thiamine diphosphate biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
THI-P-KIN-MONOMER
ECOLIWIKI:
b0417
INTERPRO:
IPR036921
INTERPRO:
IPR006283
INTERPRO:
IPR010918
INTERPRO:
IPR016188
INTERPRO:
IPR036676
MODBASE:
P0AGG0
PANTHER:
PTHR30270
PFAM:
PF00586
PFAM:
PF02769
PRIDE:
P0AGG0
PRODB:
PRO_000024061
PROTEINMODELPORTAL:
P0AGG0
REFSEQ:
NP_414951
SMR:
P0AGG0
UNIPROT:
P0AGG0


Operon      
Name: nrdR-ribDE-nusB-thiL-pgpA         
Operon arrangement:
Transcription unit        Promoter
nrdR-ribDE-nusB-thiL-pgpA
ribE-nusB-thiL-pgpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_536 436581 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB