RegulonDB RegulonDB 10.7: Gene Form
   

dxs gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dxs yajO ispA TSS_538 (cluster) TSS_538 (cluster) TSS_537 TSS_537

Gene      
Name: dxs    Texpresso search in the literature
Synonym(s): ECK0414, G6237, b0420, yajP
Genome position(nucleotides): 438315 <-- 440177 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.27
External database links:  
ASAP:
ABE-0001461
ECHOBASE:
EB3378
OU-MICROARRAY:
b0420
PORTECO:
dxs
REGULONDB:
b0420
STRING:
511145.b0420
M3D: dxs
COLOMBOS: dxs
PortEco: b0420


Product      
Name: 1-deoxy-D-xylulose-5-phosphate synthase
Synonym(s): Dxs, YajP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 67.617
Isoelectric point: 6.605
Motif(s):
 
Type Positions Sequence
478 -> 478 R
121 -> 123 GHS
320 -> 480 SYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGN
12 -> 282 ALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPIKELLKRTEEHIKGMVVPGTLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMT
153 -> 154 GA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.6 - pyridoxal 5'phosphate
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.8 - thiamin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0046872 - metal ion binding
GO:0008661 - 1-deoxy-D-xylulose-5-phosphate synthase activity
GO:0000287 - magnesium ion binding
GO:0030976 - thiamine pyrophosphate binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006744 - ubiquinone biosynthetic process
GO:0008615 - pyridoxine biosynthetic process
GO:0009228 - thiamine biosynthetic process
GO:0008299 - isoprenoid biosynthetic process
GO:0016114 - terpenoid biosynthetic process
GO:0019288 - isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
GO:0052865 - 1-deoxy-D-xylulose 5-phosphate biosynthetic process
External database links:  
DIP:
DIP-9485N
ECOCYC:
DXS-MONOMER
ECOLIWIKI:
b0420
INTERPRO:
IPR005474
INTERPRO:
IPR029061
INTERPRO:
IPR020826
INTERPRO:
IPR033248
INTERPRO:
IPR005475
INTERPRO:
IPR005477
INTERPRO:
IPR009014
MINT:
P77488
MODBASE:
P77488
PANTHER:
PTHR43322
PDB:
2O1S
PFAM:
PF02779
PFAM:
PF13292
PFAM:
PF02780
PRIDE:
P77488
PRODB:
PRO_000022495
PROSITE:
PS00802
PROSITE:
PS00801
PROTEINMODELPORTAL:
P77488
REFSEQ:
NP_414954
SMART:
SM00861
SMR:
P77488
UNIPROT:
P77488


Operon      
Name: xseB-ispA-dxs-yajO         
Operon arrangement:
Transcription unit        Promoter
xseB-ispA-dxs-yajO
yajO


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_537 438284 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_538 (cluster) 439919 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB