RegulonDB RegulonDB 10.8: Gene Form
   

thiI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thiI yajL xseB panE TSS_539 TSS_539 thiIp thiIp xseBp xseBp

Gene      
Name: thiI    Texpresso search in the literature
Synonym(s): ECK0417, G6238, b0423, nuvA, nuvC, yajK
Genome position(nucleotides): 441549 --> 442997 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.17
External database links:  
ASAP:
ABE-0001470
ECHOBASE:
EB3058
OU-MICROARRAY:
b0423
PortEco:
thiI
STRING:
511145.b0423
COLOMBOS: thiI


Product      
Name: tRNA uridine 4-sulfurtransferase
Synonym(s): NuvA, NuvC, ThiI, YajK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 54.973
Isoelectric point: 6.576
Motif(s):
 
Type Positions Sequence
28 -> 161 GNIRNVLKHYDETLAVVRHWDNIEVRAKDENQRLAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLEGKTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLL
108 -> 108 C
321 -> 321 K
183 -> 184 LI
61 -> 165 LAIRDALTRIPGIHHILEVEDVPFTDMHDIFEKALVQYRDQLEGKTFCVRVKRRGKHDFSSIDVERYVGGGLNQHIESARVKLTNPDVTVHLEVEDDRLLLIKGR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.8 - thiamin
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0003723 - RNA binding
GO:0016783 - sulfurtransferase activity
GO:0000049 - tRNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004810 - tRNA adenylyltransferase activity
biological_process GO:0009228 - thiamine biosynthetic process
GO:0034227 - tRNA thio-modification
GO:0009229 - thiamine diphosphate biosynthetic process
GO:0052837 - thiazole biosynthetic process
GO:0002937 - tRNA 4-thiouridine biosynthesis
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10985N
ECOCYC:
THII-MONOMER
ECOLIWIKI:
b0423
INTERPRO:
IPR003720
INTERPRO:
IPR036873
INTERPRO:
IPR026340
INTERPRO:
IPR001763
INTERPRO:
IPR004114
INTERPRO:
IPR014729
INTERPRO:
IPR020536
MODBASE:
P77718
PFAM:
PF02568
PFAM:
PF02926
PRIDE:
P77718
PRODB:
PRO_000024058
PROSITE:
PS50206
PROSITE:
PS51165
REFSEQ:
NP_414957
SMART:
SM00981
SMR:
P77718
UNIPROT:
P77718


Operon      
Name: thiI         
Operon arrangement:
Transcription unit        Promoter
thiI


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_539 441469 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB