RegulonDB RegulonDB 10.8: Gene Form
   

yajQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yajR panE yajQ yajL terminator anti-terminator yajQp yajQp TSS_544 TSS_544 TSS_543 TSS_543 TSS_542 (cluster) TSS_542 (cluster) TSS_541 (cluster) TSS_541 (cluster) TSS_540 TSS_540 yajLp2 yajLp2

Gene      
Name: yajQ    Texpresso search in the literature
Synonym(s): ECK0420, G6240, b0426
Genome position(nucleotides): 444683 --> 445174 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0001478
ECHOBASE:
EB3379
OU-MICROARRAY:
b0426
PortEco:
yajQ
STRING:
511145.b0426
COLOMBOS: yajQ


Product      
Name: nucleotide binding protein YajQ
Synonym(s): YajQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.344
Isoelectric point: 6.02
Motif(s):
 
Type Positions Sequence
2 -> 162 PSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDASKTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIESATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFR

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0000049 - tRNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0005525 - GTP binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-31840N
ECOCYC:
G6240-MONOMER
ECOLIWIKI:
b0426
INTERPRO:
IPR007551
INTERPRO:
IPR035571
INTERPRO:
IPR036183
INTERPRO:
IPR035570
MINT:
MINT-1226917
MODBASE:
P0A8E7
PANTHER:
PTHR30476
PFAM:
PF04461
PRIDE:
P0A8E7
REFSEQ:
NP_414960
SMR:
P0A8E7
SWISSMODEL:
P0A8E7
UNIPROT:
P0A8E7


Operon      
Name: yajQ         
Operon arrangement:
Transcription unit        Promoter
yajQ


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yajLp2 443748 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_540 443792 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_541 (cluster) 444555 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_542 (cluster) 444561 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_543 444600 forward nd [RS-EPT-CBR] [2]
  promoter TSS_544 444603 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB