RegulonDB RegulonDB 10.7: Gene Form
   

ybaV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ppiD fadM ybaV FadR fadMp1 fadMp1 ybaVp3 ybaVp3

Gene      
Name: ybaV    Texpresso search in the literature
Synonym(s): ECK0436, G6243, b0442, comEA
Genome position(nucleotides): 463937 --> 464308 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.84
External database links:  
ASAP:
ABE-0001534
ECHOBASE:
EB3039
MIM:
603546
OU-MICROARRAY:
b0442
PORTECO:
ybaV
REGULONDB:
b0442
STRING:
511145.b0442
M3D: ybaV
COLOMBOS: ybaV
PortEco: b0442


Product      
Name: helix-hairpin-helix 3 family protein
Synonym(s): YbaV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 12.704
Isoelectric point: 9.136
Motif(s):
 
Type Positions Sequence
26 -> 123 AASVAKPTAVETKAEAPAAQSKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVERNLAVLTL
59 -> 118 GTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVERNL
1 -> 25 MKHGIKALLITLSLACAGMSHSALA
60 -> 90 TRVSINNASAEELARAMNGVGLKKAQAIVSY
91 -> 120 REEYGPFKTVEDLKQVPGMGNSLVERNLAV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0003677 - DNA binding
biological_process GO:0006281 - DNA repair
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Matsuda A., et al., 2012
External database links:  
ECOCYC:
G6243-MONOMER
ECOLIWIKI:
b0442
INTERPRO:
IPR004509
INTERPRO:
IPR003583
INTERPRO:
IPR010994
MODBASE:
P0AAR8
PFAM:
PF12836
PRIDE:
P0AAR8
PROTEINMODELPORTAL:
P0AAR8
REFSEQ:
NP_414976
SMART:
SM00278
SMR:
P0AAR8
UNIPROT:
P0AAR8


Operon      
Name: ybaV         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybaVp3 463752 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Matsuda A., Kurono N., Kawano C., Shirota K., Hirabayashi A., Horino M., Etchuya R., Sobue R., Sasaki Y., Miyaue S., Sekoguchi A., Sugiura C., Shibata Y., Ito M., Ando T., Maeda S., 2012, Genome-wide screen for Escherichia coli genes involved in repressing cell-to-cell transfer of non-conjugative plasmids., Biochem Biophys Res Commun 428(4):445-50

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB