RegulonDB RegulonDB 10.7: Gene Form
   

fadM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

queC fadM ybaV FadR fadMp1 fadMp1

Gene      
Name: fadM    Texpresso search in the literature
Synonym(s): ECK0437, G6244, b0443, tesC, ybaW
Genome position(nucleotides): 464402 --> 464800 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.12
External database links:  
ASAP:
ABE-0001537
ECHOBASE:
EB3040
OU-MICROARRAY:
b0443
PORTECO:
fadM
REGULONDB:
b0443
STRING:
511145.b0443
M3D: fadM
COLOMBOS: fadM
PortEco: b0443


Product      
Name: thioesterase III
Synonym(s): FadM, TesC, YbaW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.088
Isoelectric point: 5.169
Motif(s):
 
Type Positions Sequence
11 -> 119 HLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMTAHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALITFVCIDLKTQKALAL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.2 - fatty acids
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0047617 - acyl-CoA hydrolase activity
biological_process GO:0006635 - fatty acid beta-oxidation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6244-MONOMER
ECOLIWIKI:
b0443
INTERPRO:
IPR006684
INTERPRO:
IPR029069
MODBASE:
P77712
PDB:
1NJK
PFAM:
PF13279
PRIDE:
P77712
PRODB:
PRO_000024050
PROTEINMODELPORTAL:
P77712
REFSEQ:
NP_414977
SMR:
P77712
UNIPROT:
P77712


Operon      
Name: fadM         
Operon arrangement:
Transcription unit        Promoter
 


Transcriptional Regulation      
Display Regulation             
Repressed by: FadR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB