RegulonDB RegulonDB 10.7: Gene Form
   

queC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybaE queC fadM terminator

Gene      
Name: queC    Texpresso search in the literature
Synonym(s): ECK0438, G6245, b0444, ybaX
Genome position(nucleotides): 464852 <-- 465547 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.72
External database links:  
ASAP:
ABE-0001539
ECHOBASE:
EB3041
OU-MICROARRAY:
b0444
PORTECO:
queC
REGULONDB:
b0444
STRING:
511145.b0444
M3D: queC
COLOMBOS: queC
PortEco: b0444


Product      
Name: 7-cyano-7-deazaguanine synthase
Synonym(s): QueC, YbaX
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 25.514
Isoelectric point: 5.944
Motif(s):
 
Type Positions Sequence
3 -> 213 RAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDVARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFLTLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWIDKAETWALADYYGKLDLVRNETLTCYNGFKGDGCGHCAACNLRANGLNHY
8 -> 18 FSGGQDSTTCL

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0016879 - ligase activity, forming carbon-nitrogen bonds
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008270 - zinc ion binding
biological_process GO:0008616 - queuosine biosynthetic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11311N
ECOCYC:
G6245-MONOMER
ECOLIWIKI:
b0444
INTERPRO:
IPR018317
INTERPRO:
IPR014729
MINT:
MINT-1259911
MODBASE:
P77756
PANTHER:
PTHR42914
PFAM:
PF06508
PRIDE:
P77756
PRODB:
PRO_000023669
PROTEINMODELPORTAL:
P77756
REFSEQ:
NP_414978
SMR:
P77756
UNIPROT:
P77756


Operon      
Name: queC         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB