RegulonDB RegulonDB 10.7: Gene Form
   

cof gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybaE cof decR SoxS MarA terminator anti-terminator anti-anti-terminator terminator TSS_608 TSS_608 decRp decRp TSS_607 (cluster) TSS_607 (cluster)

Gene      
Name: cof    Texpresso search in the literature
Synonym(s): ECK0440, G6246, b0446
Genome position(nucleotides): 467412 --> 468230 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.4
External database links:  
ASAP:
ABE-0001548
ECHOBASE:
EB3007
OU-MICROARRAY:
b0446
PORTECO:
cof
REGULONDB:
b0446
STRING:
511145.b0446
M3D: cof
COLOMBOS: cof
PortEco: b0446


Product      
Name: HMP-PP phosphatase
Synonym(s): Cof
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.371
Isoelectric point: 5.957
Motif(s):
 
Type Positions Sequence
6 -> 258 AFDMDGTLLMPDHHLGEKTLSTLARLRERDITLTFATGRHALEMQHILGALSLDAYLITGNGTRVHSLEGELLHRDDLPADVAELVLYQQWDTRASMHIFNDDGWFTGKEIPALLQAFVYSGFRYQIIDVKKMPLGSVTKICFCGDHDDLTRLQIQLYEALGERAHLCFSATDCLEVLPVGCNKGAALTVLTQHLGLSLRDCMAFGDAMNDREMLVSVGSGFIMGNAMPQLRAELPHLPVIGHCRNQAVSHYL
173 -> 173 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.8 - thiamin
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0016818 - hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0046872 - metal ion binding
GO:0016791 - phosphatase activity
GO:0017110 - nucleoside-diphosphatase activity
GO:0000287 - magnesium ion binding
biological_process GO:0009228 - thiamine biosynthetic process
GO:0016311 - dephosphorylation
GO:0017001 - antibiotic catabolic process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6246-MONOMER
ECOLIWIKI:
b0446
INTERPRO:
IPR000150
INTERPRO:
IPR036412
INTERPRO:
IPR023938
INTERPRO:
IPR006379
MODBASE:
P46891
PANTHER:
PTHR47267:SF2
PFAM:
PF08282
PRIDE:
P46891
PRODB:
PRO_000022318
PROSITE:
PS01228
PROSITE:
PS01229
PROTEINMODELPORTAL:
P46891
REFSEQ:
NP_414980
SMR:
P46891
UNIPROT:
P46891


Operon      
Name: cof         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_607 (cluster) 467382 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_608 468357 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB