RegulonDB RegulonDB 10.8: Gene Form
   

ybaY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tesB ybaY atl ffsp6 ffsp6 ybaYp3 ybaYp3 tesBp tesBp

Gene      
Name: ybaY    Texpresso search in the literature
Synonym(s): ECK0447, G6250, b0453
Genome position(nucleotides): 475379 --> 475951 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.93
External database links:  
ASAP:
ABE-0001574
ECHOBASE:
EB3042
OU-MICROARRAY:
b0453
PortEco:
ybaY
STRING:
511145.b0453
COLOMBOS: ybaY


Product      
Name: PF09619 family lipoprotein YbaY
Synonym(s): YbaY
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 19.431
Isoelectric point: 8.507
Motif(s):
 
Type Positions Sequence
19 -> 190 CADKSADIQTPAPAANTSISATQQPAIQQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLSFNPADVQPNARILLSAAITVNDKLVFITDTVQPVINQGGTKADLTLVPVQQTAVPVQASGGATTTVPSTSPTQVNPSSAVPAPTQY
1 -> 18 MKLVHMASGLAVAIALAA
46 -> 150 QQPNVSGTVWIRQKVALPPDAVLTVTLSDASLADAPSKVLAQKAVRTEGKQSPFSFVLSFNPADVQPNARILLSAAITVNDKLVFITDTVQPVINQGGTKADLTL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.10 - lipoprotein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
Reference(s): [1] Charoenwong D., et al., 2011
[2] Gonnet P., et al., 2004
External database links:  
DIP:
DIP-11312N
ECOCYC:
G6250-MONOMER
ECOLIWIKI:
b0453
INTERPRO:
IPR039366
MINT:
MINT-1300646
PFAM:
PF09619
PRIDE:
P77717
PROSITE:
PS51257
REFSEQ:
NP_414987
SMR:
P77717
UNIPROT:
P77717


Operon      
Name: ybaY         
Operon arrangement:
Transcription unit        Promoter
ybaY


Regulation by small RNA    
  Display Regulation
small RNA oxyS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybaYp3 475245 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ffsp6 476288 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Charoenwong D., Andrews S., Mackey B., 2011, Role of rpoS in the development of cell envelope resilience and pressure resistance in stationary-phase Escherichia coli., Appl Environ Microbiol 77(15):5220-9

 [2] Gonnet P., Rudd KE., Lisacek F., 2004, Fine-tuning the prediction of sequences cleaved by signal peptidase II: a curated set of proven and predicted lipoproteins of Escherichia coli K-12., Proteomics 4(6):1597-613

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB