RegulonDB RegulonDB 10.7: Gene Form
   

ylaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pdeB maa ylaC ylaCp ylaCp TSS_612 TSS_612 TSS_611 TSS_611

Gene      
Name: ylaC    Texpresso search in the literature
Synonym(s): ECK0452, G6253, b0458
Genome position(nucleotides): 478781 <-- 479251 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.13
External database links:  
ASAP:
ABE-0001587
ECHOBASE:
EB3989
OU-MICROARRAY:
b0458
PORTECO:
ylaC
REGULONDB:
b0458
STRING:
511145.b0458
M3D: ylaC
COLOMBOS: ylaC
PortEco: b0458


Product      
Name: putative inner membrane protein
Synonym(s): YlaC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 18.267
Isoelectric point: 7.497
Motif(s):
 
Type Positions Sequence
36 -> 56 PGLFIGMYVAFFATLAVMLQS
59 -> 79 LSGSVWLLVVLFILLNGFFFF
1 -> 152 MTEIQRLLTETIESLNTREKRDNKPRFSISFIRKHPGLFIGMYVAFFATLAVMLQSETLSGSVWLLVVLFILLNGFFFFDVYPRYRYEDIDVLDFRVCYNGEWYNTRFVPAALVEAILNSPRVADVHKEQLQKMIVRKGELSFYDIFTLARA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6253-MONOMER
ECOLIWIKI:
b0458
INTERPRO:
IPR019713
PFAM:
PF10777
PRIDE:
P0AAS0
PROTEINMODELPORTAL:
P0AAS0
REFSEQ:
NP_414991
UNIPROT:
P0AAS0


Operon      
Name: ylaC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_611 478612 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_612 478642 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB