RegulonDB RegulonDB 10.8: Gene Form
   

copA gene in Escherichia coli K-12 genome

Gene      
Name: copA    Texpresso search in the literature
Synonym(s): ECK0478, G6260, b0484, ybaR
Genome position(nucleotides): 508875 <-- 511379 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
58.28
External database links:  
ASAP:
ABE-0001681
ECHOBASE:
EB3035
MIM:
277900
OU-MICROARRAY:
b0484
PortEco:
copA
STRING:
511145.b0484
COLOMBOS: copA


Shine dalgarno      
Sequence: aactgtcttaAAGGAGtgtttTAT


Product      
Name: soluble Cu+ chaperone
Synonym(s): CopA, CopA(Z), YbaR
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.481
Isoelectric point: 4.673
Motif(s):
 
Type Positions Sequence
3 -> 113 QTIDLTLDGLSCGHCVKRVKESLEQRPDVEQADVSITEAHVTGTASAEQLIETIKQAGYDASVSHPKAKPLAESSIPSEALTAVSEALPAATADDDDSQQLLLSGMSCASC
207 -> 210 DNMM
522 -> 527 FDKTGT
794 -> 805 GILWPFTGTLLN
374 -> 377 TGEP

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
  4 - transport
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015662 - ion transmembrane transporter activity, phosphorylative mechanism
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0019829 - ATPase-coupled cation transmembrane transporter activity
GO:0043682 - copper transmembrane transporter activity, phosphorylative mechanism
GO:0015080 - silver ion transmembrane transporter activity
GO:0015662 - ion transmembrane transporter activity, phosphorylative mechanism
GO:0016887 - ATPase activity
GO:0016531 - copper chaperone activity
biological_process GO:0006811 - ion transport
GO:0006812 - cation transport
GO:0030001 - metal ion transport
GO:0006825 - copper ion transport
GO:0060003 - copper ion export
GO:0035434 - copper ion transmembrane transport
GO:0072511 - divalent inorganic cation transport
GO:0071280 - cellular response to copper ion
GO:0071292 - cellular response to silver ion
GO:1902601 - silver ion transmembrane transport
GO:0098655 - cation transmembrane transport
GO:0006825 - copper ion transport
GO:0010273 - detoxification of copper ion
Note(s): Note(s): ...[more].
Evidence: [AUP] Assay of unpurified protein
Reference(s): [1] Meydan S., et al., 2017
External database links:  
ECOCYC:
MONOMER0-4382
PFAM:
PF00403
UNIPROT:
Q59385-2


Operon      
Name: copA         
Operon arrangement:
Transcription unit        Promoter
copA


Transcriptional Regulation      
Display Regulation             
Activated by: CueR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybaPp3 508262 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybaPp4 508264 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybaPp6 508284 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_650 511367 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_651 511370 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_652 511395 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_654 511413 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Meydan S., Klepacki D., Karthikeyan S., Margus T., Thomas P., Jones JE., Khan Y., Briggs J., Dinman JD., Vazquez-Laslop N., Mankin AS., 2017, Programmed Ribosomal Frameshifting Generates a Copper Transporter and a Copper Chaperone from the Same Gene., Mol Cell 65(2):207-219

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB