RegulonDB RegulonDB 10.8: Gene Form
   

glsA gene in Escherichia coli K-12 genome

Gene      
Name: glsA    Texpresso search in the literature
Synonym(s): ECK0479, G6261, b0485, ybaS
Genome position(nucleotides): 511641 --> 512573 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.16
External database links:  
ASAP:
ABE-0001688
ECHOBASE:
EB3036
OU-MICROARRAY:
b0485
PortEco:
ybaS
STRING:
511145.b0485
COLOMBOS: glsA


Shine dalgarno      
Sequence: atctataaaaAGGAGTtaacaaaagATG


Product      
Name: glutaminase 1
Synonym(s): GlsA, YbaS
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 32.903
Isoelectric point: 4.584
Motif(s):
 
Type Positions Sequence
69 -> 69 K
24 -> 308 GQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVF
260 -> 260 S
192 -> 192 Y
244 -> 244 Y

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
  5 - cell processes --> 5.5 - adaptations --> 5.5.4 - pH
Gene Ontology Terms (GO)  
cellular_component GO:0032991 - protein-containing complex
molecular_function GO:0016787 - hydrolase activity
GO:0004359 - glutaminase activity
biological_process GO:0006537 - glutamate biosynthetic process
GO:0006541 - glutamine metabolic process
GO:0045926 - negative regulation of growth
GO:0006543 - glutamine catabolic process
GO:0010447 - response to acidic pH
Note(s): Note(s): ...[more].
Reference(s): [1] Lu P., et al., 2013
External database links:  
DIP:
DIP-11307N
ECOCYC:
G6261-MONOMER
ECOLIWIKI:
b0485
INTERPRO:
IPR012338
INTERPRO:
IPR015868
MODBASE:
P77454
PANTHER:
PTHR12544
PDB:
1U60
PFAM:
PF04960
PRIDE:
P77454
PRODB:
PRO_000022801
REFSEQ:
NP_415018
SMR:
P77454
UNIPROT:
P77454


Operon      
Name: glsA-ybaT         
Operon arrangement:
Transcription unit        Promoter
glsA-ybaT


Transcriptional Regulation      
Display Regulation             
Activated by: GadX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_650 511367 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_651 511370 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_652 511395 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_654 511413 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_655 513563 forward nd [RS-EPT-CBR] [2]
  promoter TSS_656 513566 forward nd [RS-EPT-CBR] [2]
  promoter TSS_657 513642 forward nd [RS-EPT-CBR] [2]
  promoter TSS_658 (cluster) 513647 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lu P., Ma D., Chen Y., Guo Y., Chen GQ., Deng H., Shi Y., 2013, L-glutamine provides acid resistance for Escherichia coli through enzymatic release of ammonia., Cell Res 23(5):635-44

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB