RegulonDB RegulonDB 10.8: Gene Form
   

qmcA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

qmcA fetA ybbJ cueR fetB fetAp fetAp ybbLp6 ybbLp6 TSS_659 (cluster) TSS_659 (cluster) qmcAp qmcAp ybbJp1 ybbJp1

Gene      
Name: qmcA    Texpresso search in the literature
Synonym(s): ECK0483, G6265, b0489, ybbK
Genome position(nucleotides): 514856 <-- 515773 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.83
External database links:  
ASAP:
ABE-0001697
ECHOBASE:
EB3046
OU-MICROARRAY:
b0489
PortEco:
qmcA
STRING:
511145.b0489
COLOMBOS: qmcA


Product      
Name: PHB domain-containing protein QmcA
Synonym(s): QmcA, YbbK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 33.743
Isoelectric point: 5.296
Motif(s):
 
Type Positions Sequence
238 -> 297 MVSEAIASGDIQAVNYFVAQKYTEALQQIGSSSNSKVVMMPLEASSLMGSIAGIAELVKD
3 -> 23 IFIPILIFVALVIVGAGVKIV
22 -> 202 IVPQGYQWTVERFGRYTKTLQPGLSLVVPFMDRIGRKINMMEQVLDIPSQEVISKDNANVTIDAVCFIQVIDAPRAAYEVSNLELAIINLTMTNIRTVLGSMELDEMLSQRDSINSRLLRIVDEATNPWGIKVTRIEIRDVRPPAELISSMNAQMKAERTKRAYILEAEGIRQAEILKAEG

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
Note(s): Note(s): ...[more].
Reference(s): [1] Hinderhofer M., et al., 2009
[2] Padilla-Vaca F., et al., 2019
External database links:  
DIP:
DIP-48137N
ECOCYC:
G6265-MONOMER
ECOLIWIKI:
b0489
INTERPRO:
IPR032435
INTERPRO:
IPR036013
INTERPRO:
IPR018080
INTERPRO:
IPR001972
INTERPRO:
IPR001107
PANTHER:
PTHR10264
PFAM:
PF16200
PFAM:
PF01145
PRIDE:
P0AA53
PRINTS:
PR00721
PRODB:
PRO_000023665
PROSITE:
PS01270
REFSEQ:
NP_415022
SMART:
SM00244
SMR:
P0AA53
UNIPROT:
P0AA53


Operon      
Name: qmcA-ybbJ         
Operon arrangement:
Transcription unit        Promoter
qmcA-ybbJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybbJp1 515077 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_659 (cluster) 515825 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter ybbLp6 515892 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [3], [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hinderhofer M., Walker CA., Friemel A., Stuermer CA., Moller HM., Reuter A., 2009, Evolution of prokaryotic SPFH proteins., BMC Evol Biol 9:10

 [2] Padilla-Vaca F., Vargas-Maya NI., Elizarraras-Vargas NU., Rangel-Serrano A., Cardoso-Reyes LR., Razo-Soria T., Membrillo-Hernandez J., Franco B., 2019, Flotillin homologue is involved in the swimming behavior of Escherichia coli., Arch Microbiol

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB