RegulonDB RegulonDB 10.8: Gene Form
   

fetA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

qmcA cnoX fetB fetA ybbJ TSS_661 TSS_661 fetAp fetAp ybbLp6 ybbLp6 TSS_659 (cluster) TSS_659 (cluster) qmcAp qmcAp ybbJp1 ybbJp1

Gene      
Name: fetA    Texpresso search in the literature
Synonym(s): ECK0484, G6266, b0490, ybbL
Genome position(nucleotides): 515919 --> 516596 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.43
External database links:  
ASAP:
ABE-0001703
ECHOBASE:
EB3047
OU-MICROARRAY:
b0490
PortEco:
ybbL
STRING:
511145.b0490
COLOMBOS: fetA


Product      
Name: putative iron ABC exporter ATP-binding subunit FetA
Synonym(s): FetA, YbbL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 25.382
Isoelectric point: 5.105
Motif(s):
 
Type Positions Sequence
23 -> 166 LNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFPWQIRNRQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITS
40 -> 47 GPSGCGKS
138 -> 147 LSGGEKQRIS
8 -> 225 LQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFPWQIRNRQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARYELA
158 -> 163 VLLLDE

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.7 - Fe aquisition
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
biological_process GO:0006811 - ion transport
GO:0006879 - cellular iron ion homeostasis
GO:0055072 - iron ion homeostasis
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Jindal S., et al., 2019
[2] Kumar A., et al., 2016
[3] Nicolaou SA., et al., 2013
[4] Xu Y., et al., 2017
External database links:  
DIP:
DIP-11320N
ECOCYC:
YBBL-MONOMER
ECOLIWIKI:
b0490
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003439
INTERPRO:
IPR003593
MINT:
MINT-1269507
MODBASE:
P77279
PFAM:
PF00005
PRIDE:
P77279
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
NP_415023
SMART:
SM00382
SMR:
P77279
UNIPROT:
P77279


Operon      
Name: fetAB         
Operon arrangement:
Transcription unit        Promoter
fetAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybbJp1 515077 reverse Similarity to the consensus
Read more >
[ICWHO] [5]
  promoter TSS_659 (cluster) 515825 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [6]
  promoter ybbLp6 515892 forward Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [5], [6]
  promoter TSS_661 518264 reverse nd [RS-EPT-CBR] [6]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Kumar A., Beloglazova N., Bundalovic-Torma C., Phanse S., Deineko V., Gagarinova A., Musso G., Vlasblom J., Lemak S., Hooshyar M., Minic Z., Wagih O., Mosca R., Aloy P., Golshani A., Parkinson J., Emili A., Yakunin AF., Babu M., 2016, Conditional Epistatic Interaction Maps Reveal Global Functional Rewiring of Genome Integrity Pathways in Escherichia coli., Cell Rep 14(3):648-61

 [3] Nicolaou SA., Fast AG., Nakamaru-Ogiso E., Papoutsakis ET., 2013, Overexpression of fetA (ybbL) and fetB (ybbM), Encoding an Iron Exporter, Enhances Resistance to Oxidative Stress in Escherichia coli., Appl Environ Microbiol 79(23):7210-9

 [4] Xu Y., Liu Y., Li F., Cao G., Zheng P., Sun J., Wen J., Zhang D., 2017, Identification of a new gene yecC involved in threonine export in Escherichia coli., FEMS Microbiol Lett 364(17)

 [5] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB