RegulonDB RegulonDB 10.8: Gene Form
   

ylbG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

selU ylbH ybbD ylbG ybbC ylbI

Gene      
Name: ylbG    Texpresso search in the literature
Synonym(s): ECK0495, G6273, b0502
Genome position(nucleotides): 529645 <-- 530016 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.27
External database links:  
ASAP:
ABE-0001736
ECHOBASE:
EB4033
OU-MICROARRAY:
b0502
PortEco:
ylbG
STRING:
316407.85674640
COLOMBOS: ylbG


Product      
Name: putative DNA-binding transcriptional regulator YlbG
Synonym(s): YlbG
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.916
Isoelectric point: 10.262
Motif(s):
 
Type Positions Sequence
11 -> 74 HKAGLLNLAEELSNVSKACKIMGVSRDTFYRYRELVAEGGVDAQINRSRRAPNLKNRTDEATEQ

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
molecular_function GO:0003677 - DNA binding
biological_process GO:0032196 - transposition
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48217N
ECOCYC:
G6273-MONOMER
ECOLIWIKI:
b0502
INTERPRO:
IPR038965
INTERPRO:
IPR009057
MODBASE:
P77688
PANTHER:
PTHR42648
PFAM:
PF13551
PRIDE:
P77688
REFSEQ:
NP_415035
SMR:
P77688
UNIPROT:
P77688


Operon      
Name: ylbG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB