RegulonDB RegulonDB 10.8: Gene Form
   

hyi gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gcl glxR hyi terminator TSS_673 TSS_673 TSS_672 TSS_672

Gene      
Name: hyi    Texpresso search in the literature
Synonym(s): ECK0501, G6277, b0508, gip, ybbG
Genome position(nucleotides): 535710 --> 536486 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.66
External database links:  
ASAP:
ABE-0001756
ECHOBASE:
EB1543
OU-MICROARRAY:
b0508
PortEco:
hyi
STRING:
511145.b0508
COLOMBOS: hyi


Product      
Name: hydroxypyruvate isomerase
Synonym(s): Gip, Hyi, YbbG, glyoxylate-induced protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.377
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence
21 -> 219 FEKAAQCGFRGVEFMFPYDYDIEELKHVLASNKLEHTLHNLPAGDWAAGERGIACIPGREEEFRDGVAAAIRYARALGNKKINCLVGKTPAGFSSEQIHATLVENLRYAANMLMKEDILLLIEPINHFDIPGFHLTGTRQALKLIDDVGCCNLKIQYDIYHMQRMEGELTNTMTQWADKIGHLQIADNPHRGEPGTGEI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016853 - isomerase activity
GO:0008903 - hydroxypyruvate isomerase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0046487 - glyoxylate metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Krakow G., et al., 1961
External database links:  
DIP:
DIP-9994N
ECOCYC:
G6277-MONOMER
ECOLIWIKI:
b0508
INTERPRO:
IPR017643
INTERPRO:
IPR036237
INTERPRO:
IPR026040
INTERPRO:
IPR013022
MODBASE:
P30147
PFAM:
PF01261
PRIDE:
P30147
PRODB:
PRO_000022971
REFSEQ:
NP_415041
SMR:
P30147
SWISSMODEL:
P30147
UNIPROT:
P30147


Operon      
Name: gcl-hyi-glxR-ybbW-allB-ybbY-glxK         
Operon arrangement:
Transcription unit        Promoter
gcl-hyi-glxR-ybbVW-allB-ybbY-glxK
allB
allB
allB
ybbY-glxK
glxK


Transcriptional Regulation      
Display Regulation             
Repressed by: AllR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_672 534816 forward nd [RS-EPT-CBR] [2]
  promoter TSS_673 534825 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Krakow G., Barkulis SS., Hayashi JA., 1961, Glyoxylic acid carboligase: an enzyme present in glycolate-grown Escherichia coli., J Bacteriol 81:509-18

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB