RegulonDB RegulonDB 10.8: Gene Form
   

ybbW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybbW allB glxR ybbYp ybbYp allBp allBp allBp2 allBp2 allBp3 allBp3

Gene      
Name: ybbW    Texpresso search in the literature
Synonym(s): ECK0504, G6280, allP, b0511, glxB2
Genome position(nucleotides): 537633 --> 539087 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.01
External database links:  
ASAP:
ABE-0001764
ECHOBASE:
EB3383
OU-MICROARRAY:
b0511
PortEco:
ybbW
STRING:
511145.b0511
COLOMBOS: ybbW


Product      
Name: putative allantoin transporter
Synonym(s): AllP, YbbW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 52.456
Isoelectric point: 9.136
Motif(s):
 
Type Positions Sequence
35 -> 55 LWMGSVHNVPNYVMVGGFFIL
59 -> 79 TFSIMLAIILSAFFIAAVMVL
156 -> 176 LPGLITFLIFWLVNVGIGFGG
307 -> 327 LFASFFAVLVILMTTISTNAT
19 -> 457 PKTQSQRTWKTFNYFTLWMGSVHNVPNYVMVGGFFILGLSTFSIMLAIILSAFFIAAVMVLNGAAGSKYGVPFAMILRASYGVRGALFPGLLRGGIAAIMWFGLQCYAGSLACLILIGKIWPGFLTLGGDFTLLGLSLPGLITFLIFWLVNVGIGFGGGKVLNKFTAILNPCIYIVFGGMAIWAISLVGIGPIFDYIPSGIQKAENGGFLFLVVINAVVAVWAAPAVSASDFTQNAHSFREQALGQTLGLVVAYILFAVAGVCIIAGASIHYGADTWNVLDIVQRWDSLFASFFAVLVILMTTISTNATGNIIPAGYQIAAIAPTKLTYKNGVLIASIISLLICPWKLMENQDSIYLFLDIIGGMLGPVIGVMMAHYFVVMRGQINLDELYTAPGDYKYYDNGFNLTAFSVTLVAVILSLGGKFIHFMEPLSRVSWFVG

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015205 - nucleobase transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0006144 - purine nucleobase metabolic process
GO:0055085 - transmembrane transport
GO:0015851 - nucleobase transport
Note(s): Note(s): ...[more].
Reference(s): [1] Moraes TF., et al., 2012
External database links:  
ECOCYC:
B0511-MONOMER
ECOLIWIKI:
b0511
INTERPRO:
IPR001248
INTERPRO:
IPR038271
INTERPRO:
IPR012681
PFAM:
PF02133
PRIDE:
P75712
REFSEQ:
NP_415044
SMR:
P75712
UNIPROT:
P75712


Operon      
Name: gcl-hyi-glxR-ybbW-allB-ybbY-glxK         
Operon arrangement:
Transcription unit        Promoter
gcl-hyi-glxR-ybbVW-allB-ybbY-glxK
allB
allB
allB
ybbY-glxK
glxK


Transcriptional Regulation      
Display Regulation             
Repressed by: AllR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Moraes TF., Reithmeier RA., 2012, Membrane transport metabolons., Biochim Biophys Acta 1818(11):2687-706


RegulonDB