RegulonDB RegulonDB 10.8: Gene Form
   

glxK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybbY glxK allE

Gene      
Name: glxK    Texpresso search in the literature
Synonym(s): ECK0507, G6283, b0514, glxB5, ybbZ
Genome position(nucleotides): 541888 --> 543033 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.58
External database links:  
ASAP:
ABE-0001773
ECHOBASE:
EB3386
OU-MICROARRAY:
b0514
PortEco:
glxK
STRING:
511145.b0514
COLOMBOS: glxK


Product      
Name: glycerate 2-kinase 2
Synonym(s): GlxK, YbbZ, glycerate 2-kinase II
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.734
Isoelectric point: 4.418
Motif(s):
 
Type Positions Sequence
3 -> 373 IVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGGEGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKRNPLLASSFGTGELIRHALDNDIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQALAANGGNLARVASIEMDECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEELEQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQAVQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDAVFSILPRLAPLAEVLASGETNLFNSARNIACAI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.21 - glyoxylate degradation
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.25 - glycolate metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008887 - glycerate kinase activity
GO:0043798 - glycerate 2-kinase activity
biological_process GO:0009436 - glyoxylate catabolic process
GO:0016310 - phosphorylation
GO:0046296 - glycolate catabolic process
GO:0031388 - organic acid phosphorylation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
GLY3KIN-MONOMER
ECOLIWIKI:
b0514
INTERPRO:
IPR004381
INTERPRO:
IPR036129
INTERPRO:
IPR018197
INTERPRO:
IPR018193
MODBASE:
P77364
PANTHER:
PTHR21599
PFAM:
PF02595
PRIDE:
P77364
PRODB:
PRO_000022815
REFSEQ:
NP_415047
SMR:
P77364
UNIPROT:
P77364


Operon      
Name: gcl-hyi-glxR-ybbW-allB-ybbY-glxK         
Operon arrangement:
Transcription unit        Promoter
gcl-hyi-glxR-ybbVW-allB-ybbY-glxK
allB
allB
allB
ybbY-glxK
glxK


Transcriptional Regulation      
Display Regulation             
Repressed by: AllR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB