RegulonDB RegulonDB 10.6.3: Gene Form
   

allE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

allC glxK allE ylbAp2 ylbAp2

Gene      
Name: allE    Texpresso search in the literature
Synonym(s): ECK0508, G6284, b0515, glxB6, ughY, ylbA
Genome position(nucleotides): 543261 <-- 544046 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.18
External database links:  
ASAP:
ABE-0001775
ECHOBASE:
EB3387
ECOCYC:
G6284
ECOLIHUB:
allE
OU-MICROARRAY:
b0515
REGULONDB:
b0515
STRING:
511145.b0515
M3D: allE
COLOMBOS: allE
PortEco: b0515


Product      
Name: (S)-ureidoglycine aminohydrolase
Synonym(s): AllE, UghY, YlbA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.73
Isoelectric point: 4.698
Motif(s):
 
Type Positions Sequence
225 -> 261 GDYIFMGAYSLQAGYGVGRGEAFSYIYSKDCNRDVEI
204 -> 204 A
56 -> 136 GASFVDYLVTLHQNGGNQQGFGGEGIETFLYVISGNITAKAEGKTFALSEGGYLYCPPGSLMTFVNAQAEDSQIFLYKRRY
184 -> 230 LSFAPGASHGYIETHVQEHGAYILSGQGVYNLDNNWIPVKKGDYIFM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.26 - allantoin assimilation
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0030145 - manganese ion binding
GO:0071522 - ureidoglycine aminohydrolase activity
biological_process GO:0006144 - purine nucleobase metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Puggioni V., et al., 2014
External database links:  
DIP:
DIP-12689N
ECOCYC:
G6284-MONOMER
ECOLIWIKI:
b0515
INTERPRO:
IPR013096
INTERPRO:
IPR017627
INTERPRO:
IPR014710
INTERPRO:
IPR011051
INTERPRO:
IPR008579
MODBASE:
P75713
PDB:
1RC6
PFAM:
PF07883
PFAM:
PF05899
PRIDE:
P75713
PROTEINMODELPORTAL:
P75713
REFSEQ:
NP_415048
SMR:
P75713
UNIPROT:
P75713


Operon      
Name: allDCE         
Operon arrangement:
Transcription unit        Promoter
allDC-ylbA


Transcriptional Regulation      
Display Regulation             
Activated by: AllS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ylbAp2 544056 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Puggioni V., Dondi A., Folli C., Shin I., Rhee S., Percudani R., 2014, Gene context analysis reveals functional divergence between hypothetically equivalent enzymes of the purine-ureide pathway., Biochemistry 53(4):735-45

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB