RegulonDB RegulonDB 10.8: Gene Form
   

fdrA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fdrA ylbE allD AllS anti-anti-terminator anti-terminator terminator fdrAp4 fdrAp4 allDp allDp

Gene      
Name: fdrA    Texpresso search in the literature
Synonym(s): ECK0511, G6287, b0518, ylbD
Genome position(nucleotides): 546680 --> 548347 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.58
External database links:  
ASAP:
ABE-0001784
ECHOBASE:
EB3180
OU-MICROARRAY:
b0518
PortEco:
fdrA
STRING:
511145.b0518
COLOMBOS: fdrA


Product      
Name: putative acyl-CoA synthetase FdrA
Synonym(s): FdrA, YlbD, putative acyl-CoA synthetase with NAD(P)-binding Rossmann-fold domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 58.596
Isoelectric point: 4.863
Motif(s):
 
Type Positions Sequence
476 -> 496 IAVVSSLPEATLLAAALIHPL
331 -> 351 GFICGLYTGGTLAAEAAGLLA
336 -> 491 LYTGGTLAAEAAGLLAGHLGVEADDTHQHGMMLDADSHQIIDLGDDFYTVGRPHPMIDPTLRNQLIADLGAKPQVRVLLLDVVIGFGATADPAASLVSAWQKACAARLDNQPLYAIATVTGTERDPQCRSQQIATLEDAGIAVVSSLPEATLLAAA
193 -> 287 EGNIGVIGASGTGIQELCSQIALAGEGITHAIGLGGRDLSREVGGISALTALEMLSADEKSEVLAFVSKPPAEAVRLKIVNAMKATGKPTVALFL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0048037 - cofactor binding
GO:0004550 - nucleoside diphosphate kinase activity
GO:0004775 - succinate-CoA ligase (ADP-forming) activity
biological_process GO:0006099 - tricarboxylic acid cycle
GO:0009142 - nucleoside triphosphate biosynthetic process
GO:0006165 - nucleoside diphosphate phosphorylation
GO:0006105 - succinate metabolic process
GO:0071973 - bacterial-type flagellum-dependent cell motility
GO:0006104 - succinyl-CoA metabolic process
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
Reference(s): [1] Akiyama Y., et al., 1995
External database links:  
ECOCYC:
G6287-MONOMER
ECOLIWIKI:
b0518
INTERPRO:
IPR005811
INTERPRO:
IPR016102
INTERPRO:
IPR003781
MODBASE:
Q47208
PDB:
3DMY
PFAM:
PF00549
PFAM:
PF02629
PRIDE:
Q47208
PRODB:
PRO_000022587
REFSEQ:
NP_415051
SMR:
Q47208
UNIPROT:
Q47208


Operon      
Name: fdrA-ylbEF-ybcF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter fdrAp4 546506 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Akiyama Y., Ito K., 1995, A new Escherichia coli gene, fdrA, identified by suppression analysis of dominant negative FtsH mutations., Mol Gen Genet 249(2):202-8

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB