RegulonDB RegulonDB 10.8: Gene Form
   

ylbE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fdrA ylbE ylbF ybcF

Gene      
Name: ylbE    Texpresso search in the literature
Synonym(s): ECK0512, G0-10554, G6288, b0519, b4507, b4572
Genome position(nucleotides): 548357 --> 549616 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
57.22
External database links:  
ASAP:
ABE-0285105
ECHOBASE:
EB3179
OU-MICROARRAY:
b0519
PortEco:
ylbE_2
PortEco:
ylbE_1
STRING:
316385.ECDH10B_0475
COLOMBOS: ylbE


Product      
Name: DUF1116 domain-containing protein YlbE
Synonym(s): YlbE
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 44.979
Isoelectric point: 5.105
Motif(s):
 
Type Positions Sequence
87 -> 302 VNFIPCHHVNAVGPMGGITSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFGAYGEDVLTRHRWMRDVLMPVLSAALGRMERGIDLTAMMAQGITMGDEFHQRNIASSALLMRALAPQIARLDHDKQHIAEVMDFLSVTDQFFLNLAMAYCKAAMDAGAMIRAGSIVTAMTRNGNMFGIRVSGLGERWFTAPVNTPQGLFFTGFSQEQANPDMGDS
222 -> 222 L

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6288-MONOMER
ECOLIWIKI:
b4507
ECOLIWIKI:
b0519
INTERPRO:
IPR009499
INTERPRO:
IPR024033
PFAM:
PF06545
PRIDE:
P77129
REFSEQ:
YP_009029994
SMR:
P77129
UNIPROT:
P77129


Operon      
Name: fdrA-ylbEF-ybcF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB