RegulonDB RegulonDB 10.8: Gene Form
   

ylbF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ylbE purK ybcF ylbF purE

Gene      
Name: ylbF    Texpresso search in the literature
Synonym(s): ECK0513, G6289, b0520
Genome position(nucleotides): 549627 --> 550442 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.86
External database links:  
ASAP:
ABE-0001789
ECHOBASE:
EB3391
OU-MICROARRAY:
b0520
PortEco:
ylbF
STRING:
511145.b0520
COLOMBOS: ylbF


Product      
Name: DUF2877 domain-containing protein YlbF
Synonym(s): YlbF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 29.597
Isoelectric point: 9.897
Motif(s):
 
Type Positions Sequence
159 -> 263 LGKGPGLTPSHDDTLSGMLLAAWYYGALDARSGRPFFACSDNLQLVTTAVSVSYLRYAAQGYFASPLLHFVHALSCPKRTAVAIDSLLALGHTSGADTLLGFWLG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6289-MONOMER
ECOLIWIKI:
b0520
INTERPRO:
IPR021530
PFAM:
PF11392
PRIDE:
P0AAS5
REFSEQ:
NP_415053
UNIPROT:
P0AAS5


Operon      
Name: fdrA-ylbEF-ybcF         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB