RegulonDB RegulonDB 10.8: Gene Form
   

sfmA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

folD sfmC sfmA sfmCp4 sfmCp4 sfmCp5 sfmCp5 sfmAp6 sfmAp6 sfmAp4 sfmAp4 folDp folDp TSS_679 TSS_679 ybcJp7 ybcJp7 ybcJp5 ybcJp5 ybcJp3 ybcJp3 ybcJp4 ybcJp4

Gene      
Name: sfmA    Texpresso search in the literature
Synonym(s): ECK0523, G6290, b0530
Genome position(nucleotides): 558212 --> 558754 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.57
External database links:  
ASAP:
ABE-0001825
ECHOBASE:
EB3640
OU-MICROARRAY:
b0530
PortEco:
sfmA
STRING:
511145.b0530
COLOMBOS: sfmA


Product      
Name: putative fimbrial protein SfmA
Synonym(s): SfmA
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,pilus
Molecular weight: 18.474
Isoelectric point: 4.151
Motif(s):
 
Type Positions Sequence
23 -> 180 AVVDGGTIHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRYE
1 -> 22 MKLRFISSALAAALFAATGSYA
30 -> 179 IHFEGELVNAACSVNTDSADQVVTLGQYRTDIFNAVGNTSALIPFTIQLNDCDPVVAANAAVAFSGQADAINDNLLAIASSTNTTTATGVGIEILDNTSAILKPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANADATFIMRY

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.5 - pilus
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
GO:0005576 - extracellular region
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G6290-MONOMER
ECOLIWIKI:
b0530
INTERPRO:
IPR008966
INTERPRO:
IPR036937
INTERPRO:
IPR000259
MODBASE:
P0ABW5
PFAM:
PF00419
PRIDE:
P0ABW5
REFSEQ:
NP_415063
SMR:
P0ABW5
UNIPROT:
P0ABW5


Operon      
Name: sfmA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybcJp4 556891 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ybcJp3 556967 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ybcJp5 557006 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter ybcJp7 557025 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_679 557596 reverse nd [RS-EPT-CBR] [5]
  promoter sfmAp4 558062 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter sfmAp6 558166 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter sfmCp5 558803 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter sfmCp4 558807 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB