RegulonDB RegulonDB 10.8: Gene Form
   

sfmC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sfmD sfmC sfmA sfmCp4 sfmCp4 sfmCp5 sfmCp5

Gene      
Name: sfmC    Texpresso search in the literature
Synonym(s): ECK0524, G6291, b0531
Genome position(nucleotides): 558974 --> 559666 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.57
External database links:  
ASAP:
ABE-0001828
ECHOBASE:
EB3641
OU-MICROARRAY:
b0531
PortEco:
sfmC
STRING:
511145.b0531
COLOMBOS: sfmC


Product      
Name: putative fimbrial chaperone SfmC
Synonym(s): SfmC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 25.458
Isoelectric point: 10.526
Motif(s):
 
Type Positions Sequence
24 -> 230 AGGIALGATRIIYPADAKQTAVWIRNSHTNERFLVNSWIENSSGVKEKSFIITPPLFVSEPKSENTLRIIYTGPPLAADRESLFWMNVKTIPSVDKNALNGRNVLQLAILSRMKLFLRPIQLQELPAEAPDTLKFSRSGNYINVHNPSPFYVTLVNLQVGSQKLGNAMAAPRVNSQIPLPSGVQGKLKFQTVNDYGSVTPVREVNLN
1 -> 23 MMTKIKLLMLIIFYLIISASAHA
26 -> 145 GIALGATRIIYPADAKQTAVWIRNSHTNERFLVNSWIENSSGVKEKSFIITPPLFVSEPKSENTLRIIYTGPPLAADRESLFWMNVKTIPSVDKNALNGRNVLQLAILSRMKLFLRPIQL
167 -> 222 VHNPSPFYVTLVNLQVGSQKLGNAMAAPRVNSQIPLPSGVQGKLKFQTVNDYGSVT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
biological_process GO:0006457 - protein folding
GO:0043711 - pilus organization
GO:0071555 - cell wall organization
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G6291-MONOMER
ECOLIWIKI:
b0531
INTERPRO:
IPR016148
INTERPRO:
IPR036316
INTERPRO:
IPR018046
INTERPRO:
IPR016147
INTERPRO:
IPR013783
INTERPRO:
IPR008962
INTERPRO:
IPR001829
MODBASE:
P77249
PFAM:
PF00345
PFAM:
PF02753
PRIDE:
P77249
PRINTS:
PR00969
PRODB:
PRO_000023939
PROSITE:
PS00635
REFSEQ:
NP_415064
SMR:
P77249
SWISSMODEL:
P77249
UNIPROT:
P77249


Operon      
Name: sfmCD         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter sfmCp5 558803 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter sfmCp4 558807 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB