RegulonDB RegulonDB 10.8: Gene Form
   

sfmH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sfmD sfmH sfmF

Gene      
Name: sfmH    Texpresso search in the literature
Synonym(s): ECK0526, G6293, b0533
Genome position(nucleotides): 562336 --> 563319 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.53
External database links:  
ASAP:
ABE-0001832
ECHOBASE:
EB3643
OU-MICROARRAY:
b0533
PortEco:
sfmH
STRING:
511145.b0533
COLOMBOS: sfmH


Product      
Name: putative fimbrial adhesin protein SfmH
Synonym(s): SfmH
Sequence: Get amino acid sequence Fasta Format
Cellular location: pilus
Molecular weight: 35.696
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
180 -> 327 SFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAAGPGNRPAGVMPQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQNDTPITPNDLNSVIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ
25 -> 327 EDEHYDLSNIFNSTNNQPGQIVVLPEKSGWVGVSAICPPGTLVNYTYRSYVTNFIVQETIDNYKYMQLHDYLLGAMSLVDSVMDIQFPPQNYIRMGTDPNVSQNLPFGVMDSRLIFRLKVIRPFINMVEIPRQVMFTVYVTSTPYDPLVTPVYTISFGGRVEVPQNCELNAGQIVEFDFGDIGASLFSAAGPGNRPAGVMPQTKSIAVKCTNVAAQAYLTMRLEASAVSGQAMVSDNQDLGFIVADQNDTPITPNDLNSVIPFRLDAAAAANVTLRAWPISITGQKPTEGPFSALGYLRVDYQ
1 -> 24 MAMACLCLANISWATVCANSTGVA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0009289 - pilus
molecular_function GO:0030246 - carbohydrate binding
GO:0005537 - mannose binding
biological_process GO:0007155 - cell adhesion
GO:0043711 - pilus organization
GO:0043709 - cell adhesion involved in single-species biofilm formation
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Korea CG., et al., 2010
[2] Korea CG., et al., 2011
[3] Wurpel DJ., et al., 2013
External database links:  
ECOCYC:
G6293-MONOMER
ECOLIWIKI:
b0533
INTERPRO:
IPR008966
INTERPRO:
IPR036937
INTERPRO:
IPR000259
MODBASE:
P75715
PFAM:
PF00419
PRIDE:
P75715
REFSEQ:
NP_415066
SMR:
P75715
UNIPROT:
P75715


Operon      
Name: sfmHF         
Operon arrangement:
Transcription unit        Promoter
 


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Korea CG., Badouraly R., Prevost MC., Ghigo JM., Beloin C., 2010, Escherichia coli K-12 possesses multiple cryptic but functional chaperone-usher fimbriae with distinct surface specificities., Environ Microbiol 12(7):1957-77

 [2] Korea CG., Ghigo JM., Beloin C., 2011, The sweet connection: Solving the riddle of multiple sugar-binding fimbrial adhesins in Escherichia coli: Multiple E. coli fimbriae form a versatile arsenal of sugar-binding lectins potentially involved in surface-colonisation and tissue tropism., Bioessays 33(4):300-11

 [3] Wurpel DJ., Beatson SA., Totsika M., Petty NK., Schembri MA., 2013, Chaperone-usher fimbriae of Escherichia coli., PLoS One 8(1):e52835


RegulonDB