RegulonDB RegulonDB 10.8: Gene Form
   

insE3 gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insEF3 insF3 emrE peaD insE3 unknown

Gene      
Name: insE3    Texpresso search in the literature
Synonym(s): ECK0298, G6296, b0540
Genome position(nucleotides): 566842 --> 567141 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0001855
OU-MICROARRAY:
b0540
PortEco:
insE-3
STRING:
511145.b2088
COLOMBOS: insE3


Product      
Name: DLP12 prophage; IS3 element protein InsE
Synonym(s): InsE3
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.543
Isoelectric point: 10.57
Motif(s):
 
Type Positions Sequence
12 -> 78 RKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004803 - transposase activity
biological_process GO:0006310 - DNA recombination
GO:0006313 - transposition, DNA-mediated
GO:0032196 - transposition
External database links:  
ECOCYC:
MONOMER0-4243
ECOLIWIKI:
b0540
INTERPRO:
IPR009057
INTERPRO:
IPR002514
PFAM:
PF01527
PRIDE:
P0CF68
REFSEQ:
NP_415072
SMR:
P0CF68
UNIPROT:
P0CF68


Operon      
Name: insE3EF3F3         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_682 566013 reverse nd [RS-EPT-CBR] [1]
  promoter intDp6 566101 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB