RegulonDB RegulonDB 10.8: Gene Form
   

ybcK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybcK ybcL ylcJ terminator ybcLp2 ybcLp2 ybcLp7 ybcLp7 ybcKp5 ybcKp5 ybcKp1 ybcKp1 ybcKp7 ybcKp7

Gene      
Name: ybcK    Texpresso search in the literature
Synonym(s): ECK0535, G6300, b0544
Genome position(nucleotides): 568902 --> 570428 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
35.56
External database links:  
ASAP:
ABE-0001866
ECHOBASE:
EB3392
OU-MICROARRAY:
b0544
PortEco:
ybcK
STRING:
511145.b0544
COLOMBOS: ybcK


Product      
Name: DLP12 prophage; putative recombinase YbcK
Synonym(s): YbcK
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 57.527
Isoelectric point: 9.414
Motif(s):
 
Type Positions Sequence
302 -> 357 LLRTVMKCEACGNTMIVHAVSGSLHGYYVCPMRRLHRCDRPSIKRDLVDYNIINEL
175 -> 290 PRWLSLDDKRTAFVPDPDRVKTIELIFKLRMERRSLNAIAKYLNDHAVKNFSGKESAWGPSVIEKLLANKALIGICVPSYRARGKGISEIAGYYPRVISDDLFYAVQEIRLAPFGI
3 -> 163 KAIAYMRFSSPGQMSGDSLNRQRRLIAEWLKVNSDYYLDTITYEDLGLSAFKGKHAQSGAFSEFLDAIEHGYILPGTTLLVESLDRLSREKVGEAIERLKLILNHGIDVITLCDNTVYNIDSLNEPYSLIKAILIAQRANEESEIKSSRVKLSWKKKRQDA
191 -> 284 PDRVKTIELIFKLRMERRSLNAIAKYLNDHAVKNFSGKESAWGPSVIEKLLANKALIGICVPSYRARGKGISEIAGYYPRVISDDLFYAVQEIR
4 -> 161 AIAYMRFSSPGQMSGDSLNRQRRLIAEWLKVNSDYYLDTITYEDLGLSAFKGKHAQSGAFSEFLDAIEHGYILPGTTLLVESLDRLSREKVGEAIERLKLILNHGIDVITLCDNTVYNIDSLNEPYSLIKAILIAQRANEESEIKSSRVKLSWKKKRQ

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0000150 - recombinase activity
biological_process GO:0006310 - DNA recombination
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11332N
ECOCYC:
G6300-MONOMER
ECOLIWIKI:
b0544
INTERPRO:
IPR006119
INTERPRO:
IPR038109
INTERPRO:
IPR036162
INTERPRO:
IPR025827
INTERPRO:
IPR011109
MODBASE:
P77698
PFAM:
PF07508
PFAM:
PF00239
PFAM:
PF13408
PRIDE:
P77698
PROSITE:
PS51736
PROSITE:
PS51737
REFSEQ:
NP_415076
SMART:
SM00857
SMR:
P77698
UNIPROT:
P77698


Operon      
Name: ybcK         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybcKp7 568751 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybcKp1 568787 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybcKp5 568810 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybcLp7 570845 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybcLp2 570847 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB