RegulonDB RegulonDB 10.8: Gene Form
   

ybcO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ybcN rusA ybcO ninE ipeX ylcG ylcH anti-terminator anti-anti-terminator terminator

Gene      
Name: ybcO    Texpresso search in the literature
Synonym(s): ECK0540, G6305, b0549
Genome position(nucleotides): 573084 --> 573374 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.26
External database links:  
ASAP:
ABE-0001878
ECHOBASE:
EB3396
OU-MICROARRAY:
b0549
PortEco:
ybcO
STRING:
511145.b0549
COLOMBOS: ybcO


Product      
Name: DLP12 prophage; putative nuclease YbcO
Synonym(s): DLP12 prophage; DUF1364 domain-containing protein YbcO, YbcO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.348
Isoelectric point: 8.126
Motif(s):
 
Type Positions Sequence
3 -> 92 DLRKAARGRECQVRIPGVCNGNPETSVLAHIRLTGLCGTGTKPPDLIATIACSACHDEIDRRTHFVDAGYAKECALEGMARTQVIWLKEG

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004518 - nuclease activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
biological_process GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6305-MONOMER
ECOLIWIKI:
b0549
INTERPRO:
IPR010774
PDB:
3G27
PFAM:
PF07102
PRIDE:
P68661
REFSEQ:
NP_415081
SMR:
P68661
UNIPROT:
P68661


Operon      
Name: ybcN-ninE-ybcO-rusA-ylcG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB