RegulonDB RegulonDB 10.8: Gene Form
   

rusA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rusA ybcO ninE ipeX ylcG terminator anti-terminator anti-anti-terminator quuDp3 quuDp3

Gene      
Name: rusA    Texpresso search in the literature
Synonym(s): ECK0541, G6306, b0550, rus, ybcP
Genome position(nucleotides): 573371 --> 573733 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.17
External database links:  
ASAP:
ABE-0001880
ECHOBASE:
EB4170
OU-MICROARRAY:
b0550
PortEco:
rusA
STRING:
511145.b0550
COLOMBOS: rusA


Product      
Name: DLP12 prophage; crossover junction endodeoxyribonuclease RusA
Synonym(s): DLP12 prophage; endodeoxyribonuclease RUS (Holliday junction resolvase), Rus, RusA, YbcP
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.846
Isoelectric point: 9.999
Motif(s):
 
Type Positions Sequence
13 -> 16 SNNR
9 -> 114 PWPPSNNRYYRHNRGRTHVSAEGQAYRDNVARIIKNAMLDIGLAMPVKIRIECHMPDRRRRDLDNLQKAAFDALTKAGFWLDDAQVVDYRVVKMPVTKGGRLELTI
70 -> 70 D
72 -> 72 D
101 -> 101 K

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008821 - crossover junction endodeoxyribonuclease activity
GO:0000287 - magnesium ion binding
GO:0042803 - protein homodimerization activity
GO:0000400 - four-way junction DNA binding
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
External database links:  
DIP:
DIP-16988N
ECOCYC:
G6306-MONOMER
ECOLIWIKI:
b0550
INTERPRO:
IPR016281
INTERPRO:
IPR036614
INTERPRO:
IPR008822
MODBASE:
P0AG74
PDB:
2H8C
PDB:
2H8E
PDB:
1Q8R
PFAM:
PF05866
PRIDE:
P0AG74
PRODB:
PRO_000023897
REFSEQ:
NP_415082
SMR:
P0AG74
SWISSMODEL:
P0AG74
UNIPROT:
P0AG74


Operon      
Name: ybcN-ninE-ybcO-rusA-ylcG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter quuDp3 573774 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB