RegulonDB RegulonDB 10.8: Gene Form
   

ybcQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insH2 ybcQ ylcG ipeX rusA terminator anti-terminator anti-anti-terminator quuDp3 quuDp3

Gene      
Name: ybcQ    Texpresso search in the literature
Synonym(s): ECK0543, G6307, b0551, quuD
Genome position(nucleotides): 573956 --> 574339 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.97
External database links:  
ASAP:
ABE-0001883
ECHOBASE:
EB3397
OU-MICROARRAY:
b0551
PortEco:
ybcQ
STRING:
511145.b0551
COLOMBOS: ybcQ


Product      
Name: DLP12 prophage; putative antitermination protein
Synonym(s): QDLP12, QuuD, YbcQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.176
Isoelectric point: 6.237
Motif(s):
 
Type Positions Sequence
1 -> 118 MRDIQMVLERWGAWAANNHEDVTWSSIAAGFKGLITSKVKSRPQCCDDDAMIICGCMARLKKNNSDLHDLLVDYYVVGMTFMSLAGKHCCSDGYIGKRLQKAEGIIEGMLMALDIRLE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0031564 - transcription antitermination
GO:0044010 - single-species biofilm formation
GO:0060567 - negative regulation of DNA-templated transcription, termination
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IMP] Inferred from mutant phenotype
Reference(s): [1] Mahdi AA., et al., 1996
[2] Rueggeberg KG., et al., 2013
External database links:  
ECOCYC:
G6307-MONOMER
ECOLIWIKI:
b0551
INTERPRO:
IPR010534
PFAM:
PF06530
PRIDE:
Q47274
PRODB:
PRO_000023671
REFSEQ:
NP_415083
SMR:
Q47274
UNIPROT:
Q47274


Operon      
Name: ybcQ         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter quuDp3 573774 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Mahdi AA., Sharples GJ., Mandal TN., Lloyd RG., 1996, Holliday junction resolvases encoded by homologous rusA genes in Escherichia coli K-12 and phage 82., J Mol Biol 257(3):561-73

 [2] Rueggeberg KG., Toba FA., Thompson MG., Campbell BR., Hay AG., 2013, A Q-like transcription factor regulates biofilm development in Escherichia coli by controlling expression of the DLP12 lysis cassette., Microbiology 159(Pt 4):691-700

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB