RegulonDB RegulonDB 10.8: Gene Form
   

essD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insH2 rrrD rzpD essD rzoD MprA IHF CRP OmpR CRP terminator essDp essDp nmpCp nmpCp TSS_685 TSS_685 insHp4 insHp4 TSS_684 TSS_684

Gene      
Name: essD    Texpresso search in the literature
Synonym(s): ECK0545, G6309, b0554, vlyS, ybcR
Genome position(nucleotides): 577398 --> 577613 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.69
External database links:  
ASAP:
ABE-0001895
ECHOBASE:
EB3398
OU-MICROARRAY:
b0554
PortEco:
essD
STRING:
511145.b0554
COLOMBOS: essD


Product      
Name: DLP12 prophage; putative phage lysis protein
Synonym(s): EssD, VlyS, YbcR
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.778
Isoelectric point: 10.072
Motif(s):
 
Type Positions Sequence
36 -> 58 WAAIGVLGSLVFGLLTYLTNLYF
5 -> 67 DKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSLVFGLLTYLTNLYFKIKEDKRKA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005887 - integral component of plasma membrane
biological_process GO:0019835 - cytolysis
GO:0044659 - viral release from host cell by cytolysis
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Srividhya KV., et al., 2007
External database links:  
ECOCYC:
G6309-MONOMER
ECOLIWIKI:
b0554
INTERPRO:
IPR007054
PFAM:
PF04971
PRIDE:
P0A9R2
REFSEQ:
NP_415086
SMR:
P0A9R2
UNIPROT:
P0A9R2


Operon      
Name: essD-rrrD-rzpD         
Operon arrangement:
Transcription unit        Promoter
essD-ybcS-rzpD


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_684 575744 reverse nd [RS-EPT-CBR] [2]
  promoter insHp4 575774 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_685 576858 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Srividhya KV., Krishnaswamy S., 2007, Sub classification and targeted characterization of prophage-encoded two-component cell lysis cassette., J Biosci 32(5):979-90

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB