RegulonDB RegulonDB 10.9: Gene Form
   

essD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insH2 rrrD rzpD essD rzoD MprA IHF CRP OmpR CRP terminator essDp essDp nmpCp nmpCp TSS_685 TSS_685 insHp4 insHp4 TSS_684 TSS_684

Gene      
Name: essD    Texpresso search in the literature
Synonym(s): ECK0545, G6309, b0554, vlyS, ybcR
Genome position(nucleotides): 577398 --> 577613 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.69
External database links:  
ASAP:
ABE-0001895
ECHOBASE:
EB3398
ECOLIHUB:
essD
OU-MICROARRAY:
b0554
STRING:
511145.b0554
COLOMBOS: essD


Product      
Name: DLP12 prophage; putative phage lysis protein
Synonym(s): EssD, VlyS, YbcR
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.778
Isoelectric point: 10.072
Motif(s):
 
Type Positions Sequence
36 -> 58 WAAIGVLGSLVFGLLTYLTNLYF
5 -> 67 DKLTTGVAYGTSAGSAGYWFLQLLDKVTPSQWAAIGVLGSLVFGLLTYLTNLYFKIKEDKRKA

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0005887 - integral component of plasma membrane
biological_process GO:0019835 - cytolysis
GO:0044659 - viral release from host cell by cytolysis
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Srividhya KV., et al., 2007
External database links:  
ECOCYC:
G6309-MONOMER
ECOLIWIKI:
b0554
INTERPRO:
IPR007054
PFAM:
PF04971
PRIDE:
P0A9R2
REFSEQ:
NP_415086
SMR:
P0A9R2
UNIPROT:
P0A9R2


Operon      
Name: essD-rrrD-rzpD         
Operon arrangement:
Transcription unit        Promoter
essD-ybcS-rzpD


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_684 575744 reverse nd [RS-EPT-CBR] [2]
  promoter insHp4 575774 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_685 576858 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Srividhya KV., Krishnaswamy S., 2007, Sub classification and targeted characterization of prophage-encoded two-component cell lysis cassette., J Biosci 32(5):979-90

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB