RegulonDB RegulonDB 10.8: Gene Form
   

cusS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nfrB cusS cusC cusR nfrA CusR HprR PhoB terminator anti-terminator anti-anti-terminator TSS_713 TSS_713 TSS_712 (cluster) TSS_712 (cluster) TSS_711 TSS_711 TSS_710 (cluster) TSS_710 (cluster) TSS_709 TSS_709 TSS_708 TSS_708 TSS_707 TSS_707 TSS_706 TSS_706 TSS_705 TSS_705 TSS_704 TSS_704 TSS_703 TSS_703 TSS_702 TSS_702 TSS_701 (cluster) TSS_701 (cluster) TSS_700 TSS_700 TSS_699 (cluster) TSS_699 (cluster) TSS_698 TSS_698 cusCp cusCp cusRp cusRp TSS_697 TSS_697

Gene      
Name: cusS    Texpresso search in the literature
Synonym(s): ECK0562, G6318, b0570, ybcZ
Genome position(nucleotides): 593328 <-- 594770 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.04
External database links:  
ASAP:
ABE-0001946
ECHOBASE:
EB3406
OU-MICROARRAY:
b0570
PortEco:
cusS
STRING:
511145.b0570
COLOMBOS: cusS


Product      
Name: sensor histidine kinase CusS
Synonym(s): CusS, YbcZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol,periplasmic space
Molecular weight: 53.738
Isoelectric point: 6.465
Motif(s):
 
Type Positions Sequence
16 -> 36 LTFFISLATIAAFFAFAWIMI
21 -> 21 S
202 -> 202 V
18 -> 18 F
209 -> 257 GHAPIRSVSRQIQNITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIED

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
GO:0071280 - cellular response to copper ion
GO:0071292 - cellular response to silver ion
External database links:  
DIP:
DIP-9349N
ECOCYC:
G6318-MONOMER
ECOLIWIKI:
b0570
INTERPRO:
IPR005467
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR006290
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR003660
INTERPRO:
IPR003594
MODBASE:
P77485
PDB:
5KU5
PFAM:
PF00672
PFAM:
PF02518
PFAM:
PF00512
PRIDE:
P77485
PRINTS:
PR00344
PRODB:
PRO_000022354
PROSITE:
PS50885
PROSITE:
PS50109
REFSEQ:
NP_415102
SMART:
SM00304
SMART:
SM00388
SMART:
SM00387
SMR:
P77485
UNIPROT:
P77485


Operon      
Name: cusRS         
Operon arrangement:
Transcription unit        Promoter
cusRS


Transcriptional Regulation      
Display Regulation             
Activated by: HprR, PhoB, CusR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_697 595461 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_698 595574 forward nd [RS-EPT-CBR] [1]
  promoter TSS_699 (cluster) 595588 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_700 595625 forward nd [RS-EPT-CBR] [1]
  promoter TSS_701 (cluster) 595826 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_702 596004 forward nd [RS-EPT-CBR] [1]
  promoter TSS_703 596425 forward nd [RS-EPT-CBR] [1]
  promoter TSS_704 596427 forward nd [RS-EPT-CBR] [1]
  promoter TSS_705 596430 forward nd [RS-EPT-CBR] [1]
  promoter TSS_706 596539 forward nd [RS-EPT-CBR] [1]
  promoter TSS_707 596568 forward nd [RS-EPT-CBR] [1]
  promoter TSS_708 596571 forward nd [RS-EPT-CBR] [1]
  promoter TSS_709 596810 forward nd [RS-EPT-CBR] [1]
  promoter TSS_710 (cluster) 596903 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_711 596918 forward nd [RS-EPT-CBR] [1]
  promoter TSS_712 (cluster) 596941 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_713 596946 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB