RegulonDB RegulonDB 10.8: Gene Form
   

cusR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nfrB cusS cusC cusR nfrA CusR HprR PhoB terminator anti-terminator anti-anti-terminator TSS_713 TSS_713 TSS_712 (cluster) TSS_712 (cluster) TSS_711 TSS_711 TSS_710 (cluster) TSS_710 (cluster) TSS_709 TSS_709 TSS_708 TSS_708 TSS_707 TSS_707 TSS_706 TSS_706 TSS_705 TSS_705 TSS_704 TSS_704 TSS_703 TSS_703 TSS_702 TSS_702 TSS_701 (cluster) TSS_701 (cluster) TSS_700 TSS_700 TSS_699 (cluster) TSS_699 (cluster) TSS_698 TSS_698 cusCp cusCp cusRp cusRp TSS_697 TSS_697

Gene      
Name: cusR    Texpresso search in the literature
Synonym(s): ECK0563, G6319, b0571, ylcA
Genome position(nucleotides): 594760 <-- 595443 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.8
External database links:  
ASAP:
ABE-0001948
ECHOBASE:
EB3612
OU-MICROARRAY:
b0571
PortEco:
cusR
STRING:
511145.b0571
COLOMBOS: cusR


Product      
Name: DNA-binding transcriptional activator CusR
Synonym(s): CusR, CusR response regulator, YlcA
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 25.394
Isoelectric point: 5.143
Motif(s):
 
Type Positions Sequence
2 -> 116 KLLIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVRTLL
4 -> 113 LIVEDEKKTGEYLTKGLTEAGFVVDLADNGLNGYHLAMTGDYDLIILDIMLPDVNGWDIVRMLRSANKGMPILLLTALGTIEHRVKGLELGADDYLVKPFAFAELLARVR
146 -> 221 GTRITLTSKEFTLLEFFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYML
125 -> 223 ESQFQVADLMVDLVSRKVTRSGTRITLTSKEFTLLEFFLRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRGKIDNDFEPKLIQTVRGVGYMLEV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0042802 - identical protein binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0046688 - response to copper ion
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
Reference(s): [1] Affandi T., et al., 2019
[2] DeLisa MP., et al., 2001
External database links:  
DIP:
DIP-9348N
ECOCYC:
G6319-MONOMER
ECOLIWIKI:
b0571
INTERPRO:
IPR036388
INTERPRO:
IPR016032
INTERPRO:
IPR011006
INTERPRO:
IPR039420
INTERPRO:
IPR001789
INTERPRO:
IPR001867
INTERPRO:
IPR006291
MODBASE:
P0ACZ8
PANTHER:
PTHR26402
PFAM:
PF00486
PFAM:
PF00072
PRIDE:
P0ACZ8
PRODB:
PRO_000022353
PROSITE:
PS50110
PROSITE:
PS51755
REFSEQ:
NP_415103
SMART:
SM00862
SMART:
SM00448
SMR:
P0ACZ8
UNIPROT:
P0ACZ8


Operon      
Name: cusRS         
Operon arrangement:
Transcription unit        Promoter
cusRS


Transcriptional Regulation      
Display Regulation             
Activated by: HprR, PhoB, CusR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_697 595461 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_698 595574 forward nd [RS-EPT-CBR] [3]
  promoter TSS_699 (cluster) 595588 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_700 595625 forward nd [RS-EPT-CBR] [3]
  promoter TSS_701 (cluster) 595826 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_702 596004 forward nd [RS-EPT-CBR] [3]
  promoter TSS_703 596425 forward nd [RS-EPT-CBR] [3]
  promoter TSS_704 596427 forward nd [RS-EPT-CBR] [3]
  promoter TSS_705 596430 forward nd [RS-EPT-CBR] [3]
  promoter TSS_706 596539 forward nd [RS-EPT-CBR] [3]
  promoter TSS_707 596568 forward nd [RS-EPT-CBR] [3]
  promoter TSS_708 596571 forward nd [RS-EPT-CBR] [3]
  promoter TSS_709 596810 forward nd [RS-EPT-CBR] [3]
  promoter TSS_710 (cluster) 596903 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_711 596918 forward nd [RS-EPT-CBR] [3]
  promoter TSS_712 (cluster) 596941 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_713 596946 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Affandi T., McEvoy MM., 2019, Mechanism of metal ion-induced activation of a two-component sensor kinase., Biochem J 476(1):115-135

 [2] DeLisa MP., Wu CF., Wang L., Valdes JJ., Bentley WE., 2001, DNA microarray-based identification of genes controlled by autoinducer 2-stimulated quorum sensing in Escherichia coli., J Bacteriol 183(18):5239-47

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB