RegulonDB RegulonDB 10.8: Gene Form
   

cusF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cusC cusB cusF TSS_717 TSS_717 TSS_716 TSS_716 TSS_715 TSS_715 TSS_714 TSS_714 TSS_713 TSS_713 TSS_712 (cluster) TSS_712 (cluster) TSS_711 TSS_711 TSS_710 (cluster) TSS_710 (cluster) TSS_709 TSS_709 TSS_708 TSS_708 TSS_707 TSS_707 TSS_706 TSS_706 TSS_705 TSS_705 TSS_704 TSS_704 TSS_703 TSS_703 TSS_702 TSS_702 TSS_701 (cluster) TSS_701 (cluster) TSS_700 TSS_700

Gene      
Name: cusF    Texpresso search in the literature
Synonym(s): ECK0565, G6321, b0573, cusX, ylcC
Genome position(nucleotides): 597131 --> 597463 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.35
External database links:  
ASAP:
ABE-0001967
ECHOBASE:
EB3985
OU-MICROARRAY:
b0573
PortEco:
cusF
STRING:
511145.b0573
COLOMBOS: cusF


Product      
Name: copper/silver export system periplasmic binding protein
Synonym(s): CusF, CusX, ORF110, YlcC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 12.251
Isoelectric point: 7.922
Motif(s):
 
Type Positions Sequence
22 -> 110 ANEHHHETMSEAQPQVISATGVVKGIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQDIKVSQ
57 -> 58 HH
25 -> 27 HHH
1 -> 21 MKKALQVAMFSLFTVIGFNAQ
48 -> 48 D

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005507 - copper ion binding
GO:0046914 - transition metal ion binding
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016530 - metallochaperone activity
GO:0016531 - copper chaperone activity
biological_process GO:0046688 - response to copper ion
GO:0006878 - cellular copper ion homeostasis
GO:0010043 - response to zinc ion
GO:0010272 - response to silver ion
GO:0010273 - detoxification of copper ion
Note(s): Note(s): ...[more].
Reference(s): [1] Bagchi P., et al., 2013
[2] Meir A., et al., 2015
External database links:  
DIP:
DIP-9350N
ECOCYC:
G6321-MONOMER
ECOLIWIKI:
b0573
INTERPRO:
IPR021647
PDB:
3E6Z
PDB:
2vb2
PDB:
2qcp
PDB:
1zeq
PDB:
2vb3
PFAM:
PF11604
PRIDE:
P77214
PRODB:
PRO_000022352
REFSEQ:
NP_415105
SMR:
P77214
SWISSMODEL:
P77214
UNIPROT:
P77214


Operon      
Name: cusCFBA         
Operon arrangement:
Transcription unit        Promoter
cusCFBA


Transcriptional Regulation      
Display Regulation             
Activated by: HprR, PhoB, CusR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_700 595625 forward nd [RS-EPT-CBR] [3]
  promoter TSS_701 (cluster) 595826 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_702 596004 forward nd [RS-EPT-CBR] [3]
  promoter TSS_703 596425 forward nd [RS-EPT-CBR] [3]
  promoter TSS_704 596427 forward nd [RS-EPT-CBR] [3]
  promoter TSS_705 596430 forward nd [RS-EPT-CBR] [3]
  promoter TSS_706 596539 forward nd [RS-EPT-CBR] [3]
  promoter TSS_707 596568 forward nd [RS-EPT-CBR] [3]
  promoter TSS_708 596571 forward nd [RS-EPT-CBR] [3]
  promoter TSS_709 596810 forward nd [RS-EPT-CBR] [3]
  promoter TSS_710 (cluster) 596903 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_711 596918 forward nd [RS-EPT-CBR] [3]
  promoter TSS_712 (cluster) 596941 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_713 596946 forward nd [RS-EPT-CBR] [3]
  promoter TSS_714 597240 forward nd [RS-EPT-CBR] [3]
  promoter TSS_715 597483 forward nd [RS-EPT-CBR] [3]
  promoter TSS_716 597539 forward nd [RS-EPT-CBR] [3]
  promoter TSS_717 597541 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bagchi P., Morgan MT., Bacsa J., Fahrni CJ., 2013, Robust affinity standards for Cu(I) biochemistry., J Am Chem Soc 135(49):18549-59

 [2] Meir A., Natan A., Moskovitz Y., Ruthstein S., 2015, EPR spectroscopy identifies Met and Lys residues that are essential for the interaction between the CusB N-terminal domain and metallochaperone CusF., Metallomics 7(7):1163-72

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB