RegulonDB RegulonDB 10.8: Gene Form
   

cusB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cusA cusB cusF terminator anti-terminator anti-anti-terminator TSS_719 TSS_719 TSS_718 TSS_718 TSS_717 TSS_717 TSS_716 TSS_716 TSS_715 TSS_715 TSS_714 TSS_714

Gene      
Name: cusB    Texpresso search in the literature
Synonym(s): ECK0566, G6322, b0574, ylcD
Genome position(nucleotides): 597479 --> 598702 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.72
External database links:  
ASAP:
ABE-0001969
ECHOBASE:
EB3986
OU-MICROARRAY:
b0574
PortEco:
cusB
STRING:
511145.b0574
COLOMBOS: cusB


Product      
Name: copper/silver export system membrane fusion protein
Synonym(s): CusB, YlcD
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,membrane
Molecular weight: 44.305
Isoelectric point: 5.995
Motif(s):
 
Type Positions Sequence
1 -> 28 MKKIALIIGSMIAGGIISAAGFTWVAKA
64 -> 64 M
94 -> 378 VKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVV
29 -> 407 EPPAEKTSTAERKILFWYDPMYPNTRFDKPGKSPFMDMDLVPKYADEESSASGVRIDPTQTQNLGVKTATVTRGPLTFAQSFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNAWLQLNTASEPMLLIPSQALIDTGSEQRVITVDADGRFVPKRVAVFQASQGVTALRSGLAEGEKVVSSGLFLIDSEANISGALERMRSESATHAH
109 -> 313 SFPANVSYNEYQYAIVQARAAGFIDKVYPLTVGDKVQKGTPLLDLTIPDWVEAQSEYLLLRETGGTATQTEGILERLRLAGMPEADIRRLIATQKIQTRFTLKAPIDGVITAFDLRAGMNIAKDNVVAKIQGMDPVWVTAAIPESIAWLVKDASQFTLTVPARPDKTLTIRKWTLLPGVDAATRTLQLRLEVDNADEALKPGMNA

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.8.A - Accessory Factors Involved in Transport
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005623 - cell
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0030313 - cell envelope
molecular_function GO:0005507 - copper ion binding
GO:0046914 - transition metal ion binding
GO:0005515 - protein binding
GO:0005375 - copper ion transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0006811 - ion transport
GO:0046688 - response to copper ion
GO:0006825 - copper ion transport
GO:0006878 - cellular copper ion homeostasis
GO:0055085 - transmembrane transport
GO:0010272 - response to silver ion
GO:0010273 - detoxification of copper ion
GO:0015679 - plasma membrane copper ion transport
GO:0060003 - copper ion export
Note(s): Note(s): ...[more].
Reference(s): [1] Chacon KN., et al., 2018
[2] Meir A., et al., 2017
[3] Meir A., et al., 2019
[4] Meir A., et al., 2015
[5] Meir A., et al., 2019
[6] Silver S. 2003
[7] Ucisik MN., et al., 2013
External database links:  
DIP:
DIP-9346N
ECOCYC:
G6322-MONOMER
ECOLIWIKI:
b0574
INTERPRO:
IPR006143
INTERPRO:
IPR032317
MODBASE:
P77239
PDB:
3T56
PDB:
4DNR
PDB:
4DNT
PDB:
4DOP
PDB:
3T51
PDB:
3OW7
PDB:
3OPO
PDB:
3OOC
PDB:
3NE5
PDB:
3H94
PDB:
3T53
PFAM:
PF16576
PFAM:
PF00529
PRIDE:
P77239
PRODB:
PRO_000022350
REFSEQ:
NP_415106
SMR:
P77239
UNIPROT:
P77239


Operon      
Name: cusCFBA         
Operon arrangement:
Transcription unit        Promoter
cusCFBA


Transcriptional Regulation      
Display Regulation             
Activated by: HprR, PhoB, CusR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_714 597240 forward nd [RS-EPT-CBR] [8]
  promoter TSS_715 597483 forward nd [RS-EPT-CBR] [8]
  promoter TSS_716 597539 forward nd [RS-EPT-CBR] [8]
  promoter TSS_717 597541 forward nd [RS-EPT-CBR] [8]
  promoter TSS_718 599136 forward nd [RS-EPT-CBR] [8]
  promoter TSS_719 600284 forward nd [RS-EPT-CBR] [8]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chacon KN., Perkins J., Mathe Z., Alwan K., Ho EN., Ucisik MN., Merz KM., Blackburn NJ., 2018, Trapping intermediates in metal transfer reactions of the CusCBAF export pump of Escherichia coli., Commun Biol 1:192

 [2] Meir A., Abdelhai A., Moskovitz Y., Ruthstein S., 2017, EPR Spectroscopy Targets Structural Changes in the E. coli Membrane Fusion CusB upon Cu(I) Binding., Biophys J 112(12):2494-2502

 [3] Meir A., Lepechkin-Zilbermintz V., Kahremany S., Schwerdtfeger F., Gevorkyan-Airapetov L., Munder A., Viskind O., Gruzman A., Ruthstein S., 2019, Inhibiting the copper efflux system in microbes as a novel approach for developing antibiotics., PLoS One 14(12):e0227070

 [4] Meir A., Natan A., Moskovitz Y., Ruthstein S., 2015, EPR spectroscopy identifies Met and Lys residues that are essential for the interaction between the CusB N-terminal domain and metallochaperone CusF., Metallomics 7(7):1163-72

 [5] Meir A., Walke G., Schwerdtfeger F., Gevorkyan Airapetov L., Ruthstein S., 2019, Exploring the role of the various methionine residues in the Escherichia coli CusB adapter protein., PLoS One 14(8):e0219337

 [6] Silver S., 2003, Bacterial silver resistance: molecular biology and uses and misuses of silver compounds., FEMS Microbiol Rev 27(2-3):341-53

 [7] Ucisik MN., Chakravorty DK., Merz KM., 2013, Structure and dynamics of the N-terminal domain of the Cu(I) binding protein CusB., Biochemistry 52(39):6911-23

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB