RegulonDB RegulonDB 10.8: Gene Form
   

ybdG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pheP ybdG nfsB TSS_720 TSS_720

Gene      
Name: ybdG    Texpresso search in the literature
Synonym(s): ECK0569, G6323, b0577
Genome position(nucleotides): 603416 <-- 604663 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.52
External database links:  
ASAP:
ABE-0001978
ECHOBASE:
EB2504
OU-MICROARRAY:
b0577
PortEco:
ybdG
STRING:
511145.b0577
COLOMBOS: ybdG


Product      
Name: miniconductance mechanosensitive channel YbdG
Synonym(s): YbdG
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 46.603
Isoelectric point: 8.448
Motif(s):
 
Type Positions Sequence
68 -> 88 LFHRLAFTLQGIIVNIQAVFW
149 -> 169 AILVGILMISLLIGQSPAILI
105 -> 125 LWIMMYALLSVFSLLDVILNL
25 -> 45 IFGIIFLTAVVVHIILHWVVL
142 -> 396 QGIKLIGAILVGILMISLLIGQSPAILISGLGAMAAVLMLVFKDPILGLVAGIQLSANDMLKLGDWLEMPKYGADGAVIDIGLTTVKVRNWDNTITTIPTWSLVSDSFKNWSGMSASGGRRIKRSISIDVTSIRFLDEDEMQRLNKAHLLKPYLTSRHQEINEWNRQQGSTESVLNLRRMTNIGTFRAYLNEYLRNHPRIRKDMTLMVRQLAPGDNGLPLEIYAFTNTVVWLEYESIQADIFDHIFAIVEEFGLR

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0008381 - mechanosensitive ion channel activity
GO:0042802 - identical protein binding
biological_process GO:0006811 - ion transport
GO:0006970 - response to osmotic stress
GO:0034220 - ion transmembrane transport
GO:0055085 - transmembrane transport
GO:0071470 - cellular response to osmotic stress
External database links:  
DIP:
DIP-51225N
ECOCYC:
G6323-MONOMER
ECOLIWIKI:
b0577
INTERPRO:
IPR010920
INTERPRO:
IPR030192
INTERPRO:
IPR011066
INTERPRO:
IPR006685
MODBASE:
P0AAT4
PANTHER:
PTHR30414
PFAM:
PF00924
PRIDE:
P0AAT4
REFSEQ:
NP_415109
UNIPROT:
P0AAT4


Operon      
Name: ybdG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_720 604684 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB