RegulonDB RegulonDB 10.8: Gene Form
   

ybeT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

djlB ybeU ybeT ybeR djlC ybeUp5 ybeUp5 ybeUp4 ybeUp4 ybeTp8 ybeTp8

Gene      
Name: ybeT    Texpresso search in the literature
Synonym(s): ECK0640, G6354, b0647
Genome position(nucleotides): 678852 <-- 679406 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.7
External database links:  
ASAP:
ABE-0002213
ECHOBASE:
EB3414
OU-MICROARRAY:
b0647
PortEco:
ybeT
STRING:
511145.b0647
COLOMBOS: ybeT


Product      
Name: Sel1 repeat-containing protein YbeT
Synonym(s): YbeT
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 20.915
Isoelectric point: 9.78
Motif(s):
 
Type Positions Sequence
64 -> 98 TSQYRLGEFYLHGSDGKPLDYTQARYWYEQSAEQE
100 -> 135 PRAQSKLGWIYLKGLGVKPDTRKAILWYKEAAEQGY
136 -> 169 AHAQYTLGLIYRNGSGINVNHYESQKWLKLTAKQ

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G6354-MONOMER
ECOLIWIKI:
b0647
INTERPRO:
IPR006597
INTERPRO:
IPR011990
MODBASE:
P77296
PFAM:
PF08238
PRIDE:
P77296
REFSEQ:
NP_415180
SMART:
SM00671
SMR:
P77296
UNIPROT:
P77296


Operon      
Name: ybeT         
Operon arrangement:
Transcription unit        Promoter
ybeT


Regulation by small RNA    
  Display Regulation
small RNA omrA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybeTp8 679416 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeUp4 679462 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter ybeUp5 679465 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB