RegulonDB RegulonDB 10.8: Gene Form
   

ybeU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hscC djlC ybeU ybeT ybeUp5 ybeUp5 ybeUp4 ybeUp4 ybeTp8 ybeTp8

Gene      
Name: ybeU    Texpresso search in the literature
Synonym(s): ECK0641, G6355, b0648
Genome position(nucleotides): 679508 --> 680215 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.6
External database links:  
ASAP:
ABE-0002220
ECHOBASE:
EB3415
OU-MICROARRAY:
b0648
PortEco:
ybeU
STRING:
511145.b0648
COLOMBOS: ybeU


Product      
Name: DUF1266 domain-containing protein YbeU
Synonym(s): YbeU
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 27.022
Isoelectric point: 5.105
Motif(s):
 
Type Positions Sequence
41 -> 216 LSSSWGINNRDDLIQTIYQMTDDGHANDLAGLYLTWHRSSPEEWKALIAGGSERGLIYTQFVAQTAMCCGEGGIKAWDYVRMGFLSRVGVLNKWLTEEESLWLQSRVYVRAHHYYHSWMHYFSAYSLGRLYWQSSQCEDNTSLREALTLYKYDSAGSRMFEELAAGSDRFYATLPW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6355-MONOMER
ECOLIWIKI:
b0648
INTERPRO:
IPR009677
PFAM:
PF06889
PRIDE:
P77427
REFSEQ:
NP_415181
UNIPROT:
P77427


Operon      
Name: ybeU-djlC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybeTp8 679416 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeUp4 679462 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeUp5 679465 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB