RegulonDB RegulonDB 10.8: Gene Form
   

djlC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hscC djlC ybeU ybeT ybeUp5 ybeUp5 ybeUp4 ybeUp4 ybeTp8 ybeTp8

Gene      
Name: djlC    Texpresso search in the literature
Synonym(s): ECK0642, G6356, b0649, hsc56, hscD, ybeV
Genome position(nucleotides): 680212 --> 681663 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.73
External database links:  
ASAP:
ABE-0002222
ECHOBASE:
EB3416
OU-MICROARRAY:
b0649
PortEco:
djlC
STRING:
511145.b0649
COLOMBOS: djlC


Product      
Name: co-chaperone DjlC
Synonym(s): DjlC, Hsc56, HscD, YbeV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 55.682
Isoelectric point: 4.368
Motif(s):
 
Type Positions Sequence
458 -> 482 ITSIIKISLTVLVIGYALGKIAMLF
3 -> 70 TCWQILEIESTTQIDIIRQAYLARLPLCHPETDPQGFKALRQAYEEALRLAVNPVEEADDEEKDAAAE
31 -> 33 HPE

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005887 - integral component of plasma membrane
molecular_function GO:0001671 - ATPase activator activity
biological_process GO:0046686 - response to cadmium ion
GO:0032781 - positive regulation of ATPase activity
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G6356-MONOMER
ECOLIWIKI:
b0649
INTERPRO:
IPR036869
PRIDE:
P77359
PROSITE:
PS00636
PROSITE:
PS50076
REFSEQ:
NP_415182
SMART:
SM00271
SMR:
P77359
UNIPROT:
P77359


Operon      
Name: ybeU-djlC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ybeTp8 679416 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeUp4 679462 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ybeUp5 679465 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB